[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:cydC"

cydC        "Transport ATP-binding protein"
            ""

OrgPattern ON87MEGEOOPLOKPLaHLMDKGYoLPagQbPFCEDC9HGHEBTVOTjKQ*wb8LZIOVKNKJCV169 MQiG*ZeennoUURURROO-OdAAY*OOOOOQmppqu***LwS*r*pfodWLxyzMSh99kwsk*hv***acYXXydajP*icCADADUVQJ5MCFL1-EGSJKHdMYKT54444446569999EUNGRXOKUUYPdjjtwHGG*PrkopeckZbVVSKPKSKbfZn***ZLTKMILHQIMJIWSYJImbBPcy************************gjt**jrz**xtz**XjklklhiijjjjiiYfYac*pcg**hRkfsxxPP**fXUcmkikoqquzys****vyvtspvyqusdddcbefghhhbd*svkjivvylk*w*********h*kw***cfec*tly**mpRG**odTXgeTXfcnkNYaVMcVPPJLLLIMdT***ZSr****x**v**z*yw**-fl*bZ*h***QD**************KEN**********RQRRRRRRmQWJQhV*66676666767988BC8ABA8999A97B7KDEKDEs**t*******ststm*****yyycv******s9Iuunwfjjj*w****WgcKXKOhPEGECFEETTQUmbZs*MZRlfObqSSeIdbaTSSdQZONPMtrRuOLKNFJHJLHE99BDCABABGOEFIMLojtToVaHRKuOVWYUOUYUSSVRYXaXXX5-HJUPM332222*t**W*tw*z*x*z*uv-*uvxyvyyx***yrtvssu*****pvfqtlpnrqrrsoprppo*rmkrrrrU6************44LFEHEEFNPPPKFzc*XVWVbTHOPONUOQbKMONMGUGKTkbnpnmt***n**vqb***FFGDFGGFFMiqo*nooonz**vvOPNJKKKJLLDDDD98NRSRIIHJ77665867*CXCBBBD-BBDAED9IJHCCKB9AAAAUgmVQd*ekdDZJ 7799pnR-yRDAalWMRULNUZWhViVMMGHHHVXSIQPPMMLHHGWQUgabkfQQXMNLLMHDE9AB2GA6FEHCD2DF9BBBIF69-VkGRPTOFFFLFBJTVJ8Twr*gqf*q*XPNNOeT**P*M***3*b*UQROpNR*jMWQRInNJ*PfbazQq*V*YbT*js*ys*eIPMI*AFHNOxlm*L**QO****f ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFKKIPLLQELKKDTWVKPFLKKYKKTLVLAIFLGILTFFCAGALMFNSGYLISRSATRP:Sequence : ==========================================:RP:SCP|19->140|2hydA2|2e-09|23.1|121/323|f.37.1.1 : ==================================================:BL:SWS|11->583|CYDD_BACSU|e-127|43.3|568/575 61: . . . * . .: 120 :ENILLVYVPIVLTRAFGVGRPVFHYLERLTSHNWVFKMTSDLRVKLYKALEKDAVFFKSK:Sequence :============================================================:RP:SCP|19->140|2hydA2|2e-09|23.1|121/323|f.37.1.1 :============================================================:BL:SWS|11->583|CYDD_BACSU|e-127|43.3|568/575 121: . . + . . .: 180 :YQLGDVLGLLSEDINHIQNLYLRTIFPTFVAWGLYVFIVIGVGIFSIWMGLLMLLMIGIM:Sequence : XXXXXXXXXX :SEG|156->165|vfivigvgif : XXXXXXXXXXXX:SEG|169->181|mgllmllmigiml :==================== :RP:SCP|19->140|2hydA2|2e-09|23.1|121/323|f.37.1.1 :============================================================:BL:SWS|11->583|CYDD_BACSU|e-127|43.3|568/575 181: . * . . . .: 240 :LVAFPIWSVIVNGARQEYEKKIKNELYLDLTDNIVGITDWIFAQRGRDYVKLHEQNEEKL:Sequence :X :SEG|169->181|mgllmllmigiml :============================================================:BL:SWS|11->583|CYDD_BACSU|e-127|43.3|568/575 241: + . . . . *: 300 :MDVQEKLHHFDQIRDYLLQLVFMLVVVSFILWGGTYLGGSNGVYTGLANWIAAFVLCLFP:Sequence :============================================================:BL:SWS|11->583|CYDD_BACSU|e-127|43.3|568/575 301: . . . . + .: 360 :VVDAFAVIPAASQETNVYKDSLVRLNRLQDNSFEEEKSEIKLIAPYDIKLDNVHFRYENG:Sequence : =============:RP:SCP|348->579|1b0uA|4e-37|30.0|227/258|c.37.1.12 :============================================================:BL:SWS|11->583|CYDD_BACSU|e-127|43.3|568/575 361: . . . * . .: 420 :SREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQI:Sequence :============================================================:RP:SCP|348->579|1b0uA|4e-37|30.0|227/258|c.37.1.12 :============================================================:BL:SWS|11->583|CYDD_BACSU|e-127|43.3|568/575 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|389->512|PF00005|1e-11|40.2|107/123|ABC_tran 421: . . + . . .: 480 :SNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDE:Sequence :============================================================:RP:SCP|348->579|1b0uA|4e-37|30.0|227/258|c.37.1.12 :============================================================:BL:SWS|11->583|CYDD_BACSU|e-127|43.3|568/575 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|389->512|PF00005|1e-11|40.2|107/123|ABC_tran 481: . * . . . .: 540 :AGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDKTLIWIT:Sequence :============================================================:RP:SCP|348->579|1b0uA|4e-37|30.0|227/258|c.37.1.12 :============================================================:BL:SWS|11->583|CYDD_BACSU|e-127|43.3|568/575 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|389->512|PF00005|1e-11|40.2|107/123|ABC_tran : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|486->552|PF02463|1e-04|35.8|67/536|SMC_N 541: + . . . . *: 600 :HHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKLKAIDEGR :Sequence :======================================= :RP:SCP|348->579|1b0uA|4e-37|30.0|227/258|c.37.1.12 :=========================================== :BL:SWS|11->583|CYDD_BACSU|e-127|43.3|568/575 :$$$$$$$$$$$$ :RP:PFM|486->552|PF02463|1e-04|35.8|67/536|SMC_N