[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99837.1 lsal0 cydC "Transport ATP-binding protein"
MFKKIPLLQELKKDTWVKPFLKKYKKTLVLAIFLGILTFFCAGALMFNSGYLISRSATRP
ENILLVYVPIVLTRAFGVGRPVFHYLERLTSHNWVFKMTSDLRVKLYKALEKDAVFFKSK
YQLGDVLGLLSEDINHIQNLYLRTIFPTFVAWGLYVFIVIGVGIFSIWMGLLMLLMIGIM
LVAFPIWSVIVNGARQEYEKKIKNELYLDLTDNIVGITDWIFAQRGRDYVKLHEQNEEKL
MDVQEKLHHFDQIRDYLLQLVFMLVVVSFILWGGTYLGGSNGVYTGLANWIAAFVLCLFP
VVDAFAVIPAASQETNVYKDSLVRLNRLQDNSFEEEKSEIKLIAPYDIKLDNVHFRYENG
SREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQI
SNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDE
AGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDKTLIWIT
HHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKLKAIDEGR
//