[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:dnaB.1"

dnaB        "Chromosome replication initiation / membrane attachment protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111-----11-----------1111111111111---111---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------1----1---------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDSALNKLSPKDGYLVSASTYIDNHDIEIVQVLYQPIIGIVAVALYSYLRFEIDSKLILS:Sequence : ==:RP:SCP|59->256|1ij5A|1e-04|26.7|176/305|a.39.1.9 : ===================================================:BL:SWS|10->434|DNAB_BACSU|1e-29|25.7|417/472 61: . . . * . .: 120 :ERKLNKNIIDGLGISIPELYDARLKLEATGLIKTFEGEDKLGKYHIYELQKPLNEVKFFT:Sequence :============================================================:RP:SCP|59->256|1ij5A|1e-04|26.7|176/305|a.39.1.9 :============================================================:BL:SWS|10->434|DNAB_BACSU|1e-29|25.7|417/472 121: . . + . . .: 180 :DDLLSTALLEMVGNEKFKKLSLWNKFDNNYHDKKEVTKQFFDVFNLNKDNIVLQAQLNNS:Sequence :============================================================:RP:SCP|59->256|1ij5A|1e-04|26.7|176/305|a.39.1.9 :============================================================:BL:SWS|10->434|DNAB_BACSU|1e-29|25.7|417/472 181: . * . . . .: 240 :KISNDESLINRQKVSLDMTVFSDFIKNSYVSSDDVMNHLDIIKSVKLVYGIDEFQLVKLL:Sequence :============================================================:RP:SCP|59->256|1ij5A|1e-04|26.7|176/305|a.39.1.9 :============================================================:BL:SWS|10->434|DNAB_BACSU|1e-29|25.7|417/472 241: + . . . . *: 300 :EKAINVTNNKIDYNEFKKLAQKNFDSGIRRNFKKNKIVETAKAKDDEKDKNIDPLVNAFK:Sequence : XXXXXXXXXXXX :SEG|282->293|kakddekdknid :================ :RP:SCP|59->256|1ij5A|1e-04|26.7|176/305|a.39.1.9 :============================================================:BL:SWS|10->434|DNAB_BACSU|1e-29|25.7|417/472 301: . . . . + .: 360 :AYVPLEFLEILKNELGSFVTANERYAVKTLVEKQMLPNEVINVLIHYLLVVQDSSTILKG:Sequence :============================================================:BL:SWS|10->434|DNAB_BACSU|1e-29|25.7|417/472 361: . . . * . .: 420 :TFERIAADWTKKKIKNAQEAMTYVKSFTREKSLQRKATKKDSKGRKSNVIVKEKLPEWAK:Sequence :============================================================:BL:SWS|10->434|DNAB_BACSU|1e-29|25.7|417/472 421: . . + . . .: 480 :EKGKNKLTDVGKKENKEIDELLKKINGK :Sequence :============== :BL:SWS|10->434|DNAB_BACSU|1e-29|25.7|417/472