[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99301.1 lsal0 dnaB.1 "Chromosome replication initiation / membrane attachment protein"
MDSALNKLSPKDGYLVSASTYIDNHDIEIVQVLYQPIIGIVAVALYSYLRFEIDSKLILS
ERKLNKNIIDGLGISIPELYDARLKLEATGLIKTFEGEDKLGKYHIYELQKPLNEVKFFT
DDLLSTALLEMVGNEKFKKLSLWNKFDNNYHDKKEVTKQFFDVFNLNKDNIVLQAQLNNS
KISNDESLINRQKVSLDMTVFSDFIKNSYVSSDDVMNHLDIIKSVKLVYGIDEFQLVKLL
EKAINVTNNKIDYNEFKKLAQKNFDSGIRRNFKKNKIVETAKAKDDEKDKNIDPLVNAFK
AYVPLEFLEILKNELGSFVTANERYAVKTLVEKQMLPNEVINVLIHYLLVVQDSSTILKG
TFERIAADWTKKKIKNAQEAMTYVKSFTREKSLQRKATKKDSKGRKSNVIVKEKLPEWAK
EKGKNKLTDVGKKENKEIDELLKKINGK
//