[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:dnaB.2"

dnaB        "Replicative DNA helicase"
            ""

OrgPattern -------------------------------------------------------------------- 1111211111211111111-12111111111112121111111111113111111111111111111111111111111111111111112122111-11111111111121221111221111111111111111111111111112111111111111111211132311111111111211111111111222222132123425211111122311211111111113211111122211111111111112111111111111111121111112111111111111111111111222111111111121111111121111111112122112431121111111111111211111111112111111111115113111111111111111111111112-112214212111111111111111211111111111111111111111112111111111111112Q11111111111111111111111111111111112111111111111111411111112211412131111111121111232211111112111221111114111122112111111111111111-111111111111111111111111111111111111111111111111111111111111111111112113211211121232121131211122211111121112113323122112212212213111223211211111111311111111111111111111111121221--132131122121111112221211121131112111111111111141111111111111121112211111111111111422111111115D921112122111111111111111112111111112 -------------2-----------------------------------------------------------------------------------------------------------------------------------------------------1---------1-1------------3-----1---- ---------1-------------------1-----------------------1-----11---------------------------------1--1-------1-----1-------------------------1---1-11--1-----2-11--------1---------

Master   AminoSeq   


1: . . . . + .: 60 :MNNDIMTDNLPPQNIEAEQAVLGAIFLNTDALADAMEYVEPDDFYRRAHQILFQAMVDLN:Sequence : ==================================================:RP:SCP|11->112|1b79A|1e-34|47.1|102/102|a.81.1.1 : =========================================================:BL:SWS|4->455|DNAC_BACSU|e-151|62.9|437/454 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->112|PF00772|3e-28|53.5|101/103|DnaB 61: . . . * . .: 120 :NDGEAIDVLTVQNYLTTNNQLDDVGGVAYIAELATSVPTAANAGYYAKIVEEKSMLRRLI:Sequence :==================================================== :RP:SCP|11->112|1b79A|1e-34|47.1|102/102|a.81.1.1 :============================================================:BL:SWS|4->455|DNAC_BACSU|e-151|62.9|437/454 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|12->112|PF00772|3e-28|53.5|101/103|DnaB 121: . . + . . .: 180 :STATNIITQANNGDDDVPSLLDSAERQIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQ:Sequence :============================================================:BL:SWS|4->455|DNAC_BACSU|e-151|62.9|437/454 181: . * . . . .: 240 :SEDITGLPTGYREFDKMTAGLQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFS:Sequence : ==========================================================:RP:SCP|183->403|1n0wA|3e-28|15.2|204/210|c.37.1.11 :============================================================:BL:SWS|4->455|DNAC_BACSU|e-151|62.9|437/454 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|187->368|PF03796|2e-58|60.8|181/184|DnaB_C 241: + . . . . *: 300 :LEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMA:Sequence :============================================================:RP:SCP|183->403|1n0wA|3e-28|15.2|204/210|c.37.1.11 :============================================================:BL:SWS|4->455|DNAC_BACSU|e-151|62.9|437/454 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|187->368|PF03796|2e-58|60.8|181/184|DnaB_C 301: . . . . + .: 360 :EIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLAKELSVPILAL:Sequence :============================================================:RP:SCP|183->403|1n0wA|3e-28|15.2|204/210|c.37.1.11 :============================================================:BL:SWS|4->455|DNAC_BACSU|e-151|62.9|437/454 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|187->368|PF03796|2e-58|60.8|181/184|DnaB_C 361: . . . * . .: 420 :SQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERGESKSEEDGDDQDSLN:Sequence :=========================================== :RP:SCP|183->403|1n0wA|3e-28|15.2|204/210|c.37.1.11 :============================================================:BL:SWS|4->455|DNAC_BACSU|e-151|62.9|437/454 :$$$$$$$$ :RP:PFM|187->368|PF03796|2e-58|60.8|181/184|DnaB_C 421: . . + . . .: 480 :QDVGEVELIIEKNRAGARGTVKLLFIKSYNKFSNISYAQEPPM :Sequence :=================================== :BL:SWS|4->455|DNAC_BACSU|e-151|62.9|437/454