[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:efp.1"

efp         "Protein Translation Elongation Factor P"
            ""

OrgPattern -------------------------------------------------------------------- 1221111111111111111-111111111111111111111111111111111111111111111111111-1111111111111111111111221--1111111211122222222222222211111111111111112221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121222212221111232221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111221111111111111111111111-11111111121111111111111111111112222211111111111111111111111111111111111111111111111111111111111111211111111111111111111112111111111111111111111111111111111111111112111111111111222222222111111111111111111111111111111111111112222122212111111111111111211-1111111111122222222222222222-222222222222222122222222222222222222121222222222222112222222122221112111111111122121111111111111111111111111111111111111111111111111111122222222222222222222222222222111111111-1111111111111111-11111111111111111111111111111111 ------------111----------------------------------------------------------------------------------------1----31-----------------------------------------------------1-----------1222F-11122222-221111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MISVNEFKNGLTIEVDGELWRVVEFQHVKPGKGSAFVRSKLKNLRTGAVQEKTFRAGEKV:Sequence :EEEGGGccTTcEEEETTEEEEEEEEEEEcccccccEEEEEEEETTTccEEEEEEETTcEE:Sec Str :============================================================:RP:SCP|1->62|1uebA1|2e-21|50.0|62/63|b.34.5.2 :============================================================:BL:SWS|1->185|EFP_ANOFW|1e-84|77.8|185/185 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->60|PF08207|4e-18|75.0|56/58|EFP_N 61: . . . * . .: 120 :NQAQIDRKKMQYLYADGDNYVFMDTNTYEQLELPGSQIEEELKYMKENMVVSIIMFGTET:Sequence :EEEccEEEEEEEEEEETTEEEEEcccEEcccccccHHHHHHHHHHHHHcEEEEEEETTEE:Sec Str :== :RP:SCP|1->62|1uebA1|2e-21|50.0|62/63|b.34.5.2 : ========================================================:RP:SCP|65->126|1bkbA2|1e-20|22.6|62/65|b.40.4.5 :============================================================:BL:SWS|1->185|EFP_ANOFW|1e-84|77.8|185/185 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|67->116|PF01132|2e-13|58.0|50/55|EFP 121: . . + . . .: 180 :LGVELPNTVDLEVKETEPGIKGDTSSGGSKPATMETGLVVQVPFFVSEGDVLTINTSDGT:Sequence :EEEEEEcEEEEEEEEcccccccccccccEEEEEETTccEEEEETTccTTcEEEEETTTTE:Sec Str : #################### :PROS|150->169|PS01275|EFP|PDOC00981| :====== :RP:SCP|65->126|1bkbA2|1e-20|22.6|62/65|b.40.4.5 : ====================================================:RP:SCP|129->185|1uebA3|1e-13|59.6|57/58|b.40.4.5 :============================================================:BL:SWS|1->185|EFP_ANOFW|1e-84|77.8|185/185 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|129->184|PF09285|1e-15|66.1|56/56|Elong-fact-P_C 181: . * . . . .: 240 :YISRA :Sequence :EEEEc :Sec Str :===== :RP:SCP|129->185|1uebA3|1e-13|59.6|57/58|b.40.4.5 :===== :BL:SWS|1->185|EFP_ANOFW|1e-84|77.8|185/185 :$$$$ :RP:PFM|129->184|PF09285|1e-15|66.1|56/56|Elong-fact-P_C