[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99339.1 lsal0 efp.1 "Protein Translation Elongation Factor P"
MISVNEFKNGLTIEVDGELWRVVEFQHVKPGKGSAFVRSKLKNLRTGAVQEKTFRAGEKV
NQAQIDRKKMQYLYADGDNYVFMDTNTYEQLELPGSQIEEELKYMKENMVVSIIMFGTET
LGVELPNTVDLEVKETEPGIKGDTSSGGSKPATMETGLVVQVPFFVSEGDVLTINTSDGT
YISRA
//