[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:fabH.1"

fabH        "3-oxoacyl-[acyl-carrier-protein] synthase III"
            ""

OrgPattern -------------------------------------------------------------------- 11314---------32211-11--22111112111152221333112111111211121121112235631--------11-111111422114112--225344135141111111111111112111111121111111---2111111111111111112111111311111111111111121111-112444442253423222132212342111111111111132111111111111111121111-111111-1-2211111222211111111111111111111111111111111111111211111111111122222222222241223111-23--1111111111113111131122212222211111221111122222222222222222-33133112232222211121111112233122111122211111111111111111111111111--11111111211111111-2112121111411214333331131444432213111111222111112112111131212311111111111111243111111121111222422222222234221111122212311111111111111113311211221132222532222242222251-11111------12211111112111111-1111121111111111112111221211111111111111111211111111-1121222122221111222213444113111111111111111111111111111--44442425122221342111111111111122222232232113232222311111113--1111--------1-1-------------------------11----2---121 1-------1----1----------------------------------------------------------------------------------------------41----------------------------------------------------1-------------111A111115115-11-1----1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MENIEISYTARYVPPEVIDNQRLTEFMDTSDEWISQRTGIKKRHISLNESTADLAKKVAE:Sequence : ccEEEEEEEEcccccccTTccGGGcTTcEEEEEEEEcccccTTccccEEEEEEEETTTT:Sec Str : =======================================================:RP:SCP|6->171|1eblA1|3e-49|35.5|166/174|c.95.1.2 :============================================================:BL:SWS|1->326|FABH_LACRJ|2e-96|54.6|324/324 61: . . . * . .: 120 :KLLTKSGWNPNSLDLIIVATMSPNSFTPATAAIVQGRISADNAVCFDISAACSGYIYGLS:Sequence :ccccccEEEEEEEEEEccccccHccHHHHHHcEEcccEEEEEGGGHHHcHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|6->171|1eblA1|3e-49|35.5|166/174|c.95.1.2 :============================================================:BL:SWS|1->326|FABH_LACRJ|2e-96|54.6|324/324 : $$$$$$$$$$$$$$$:RP:PFM|106->171|PF08545|4e-19|51.5|66/79|ACP_syn_III 121: . . + . . .: 180 :IVEAMLRNMNLKRAMLIGSENLSKLIDWNDRSTAVLFGDGAAGALIELKEDTDSKFISSD:Sequence :HTHHHHccccccccccEEEEEccTTccGGGccccHHHHHHHHHTcccccccccccEETTE:Sec Str :=================================================== :RP:SCP|6->171|1eblA1|3e-49|35.5|166/174|c.95.1.2 :============================================================:BL:SWS|1->326|FABH_LACRJ|2e-96|54.6|324/324 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|106->171|PF08545|4e-19|51.5|66/79|ACP_syn_III 181: . * . . . .: 240 :LKTIGNEAEFLTAGITDPLEKFPDLDSIRKYTTFKMDGRRVYTFATREVPQSILRAVQKA:Sequence :EcEEEEEEEEEEETEEEEEEEEEETEccccGGGcccTTccHHHHccTTcHHHHHHHHHHH:Sec Str : ===========================:RP:SCP|214->326|1u0mA2|3e-28|21.2|113/148|c.95.1.2 :============================================================:BL:SWS|1->326|FABH_LACRJ|2e-96|54.6|324/324 : $$$:RP:PFM|238->325|PF08541|5e-22|52.3|88/90|ACP_syn_III_C 241: + . . . . *: 300 :NLSLEDIDYFILHQANSRIIRQVAKKLKQDEEKFPINIDSFGNTSAASEPLLLDELIENG:Sequence :TccGGHccEEEEEEEcccccHHHHHHHHHTHHHHHHTTTccccTTcEEEEEEEEcccccc:Sec Str :============================================================:RP:SCP|214->326|1u0mA2|3e-28|21.2|113/148|c.95.1.2 :============================================================:BL:SWS|1->326|FABH_LACRJ|2e-96|54.6|324/324 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|238->325|PF08541|5e-22|52.3|88/90|ACP_syn_III_C 301: . . . . + .: 360 :TVKRGMTLALSGFGGGLTVGTHIIKY :Sequence :cGGccccccccccccGGGEEEEEEEc :Sec Str :========================== :RP:SCP|214->326|1u0mA2|3e-28|21.2|113/148|c.95.1.2 :========================== :BL:SWS|1->326|FABH_LACRJ|2e-96|54.6|324/324 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|238->325|PF08541|5e-22|52.3|88/90|ACP_syn_III_C