[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99261.1 lsal0 fabH.1 "3-oxoacyl-[acyl-carrier-protein] synthase III"
MENIEISYTARYVPPEVIDNQRLTEFMDTSDEWISQRTGIKKRHISLNESTADLAKKVAE
KLLTKSGWNPNSLDLIIVATMSPNSFTPATAAIVQGRISADNAVCFDISAACSGYIYGLS
IVEAMLRNMNLKRAMLIGSENLSKLIDWNDRSTAVLFGDGAAGALIELKEDTDSKFISSD
LKTIGNEAEFLTAGITDPLEKFPDLDSIRKYTTFKMDGRRVYTFATREVPQSILRAVQKA
NLSLEDIDYFILHQANSRIIRQVAKKLKQDEEKFPINIDSFGNTSAASEPLLLDELIENG
TVKRGMTLALSGFGGGLTVGTHIIKY
//