[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:glgP"

glgP        "Glycogen phosphorylase"
            ""

OrgPattern --------------------------------------------------111-11------------ 121--1112231--1------1--1-------1---------------1--------------1-------11111112--1-11-------1-----------------111111111111111---------1-----------2322222--111111111223---2111111111111----1111-1-111111111111111-111-1111--1-111--------1--------------------1--11-----11--11-1----1111111222222111111111111111111111111232111221212-13-------2-2111122121-122-22--11-1---1-----1-12-11----------111111111111------------1111111121--111111111111--1---1111111----------1---1111-------------------------------1---------------------12--------1111------1-----1-11---21211----------------221--11-22----31312131211111122------------------------1111121-1--1-111111-1-111111-11-----1--1------22222212222222222-22222222222222222222332211-222222222222222222222222--211122212222-------------2----222232-11112111----------1-11111111111111111111111111111111111111111----------------2-11------------1-1-------------------------1--11----121- --11222----11111111111111111111111111111-111111111111111111111111111121111111111111111---121111111111--2-2-1--28445553223333443637T3-5361323333431333433133424313A21142211312311223m334325235123------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDFNKEVFKEKFKNRLDEKYALDVKDATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGK:Sequence : HHHTTccccTTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc:Sec Str : XXXXXXXXXXXX :SEG|3->14|fnkevfkekfkn : ==============================================:RP:SCP|15->798|1a8iA|0.0|41.9|775/813|c.87.1.4 : ==============================================:BL:SWS|15->797|PHSG_BACSU|0.0|47.6|781/798 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->119|PF02990|3e-05|35.9|92/517|EMP70 61: . . . * . .: 120 :KQIYYFSIEFLPGRLLMSNLLNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRL:Sequence :cEEEEEcccccccccHHHHHHHHTcHHHHHHHHHHTTccHHHHHTTccccTTcccHHHHH:Sec Str :============================================================:RP:SCP|15->798|1a8iA|0.0|41.9|775/813|c.87.1.4 :============================================================:BL:SWS|15->797|PHSG_BACSU|0.0|47.6|781/798 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|28->119|PF02990|3e-05|35.9|92/517|EMP70 : $$$$$$$$:RP:PFM|113->160,296->684|PF00343|e-120|52.8|436/455|Phosphorylase 121: . . + . . .: 180 :ASAFMDSLASDGLPGNGNGIRYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVT:Sequence :HHHHHHHHHHTTccEEEEEEcccccccEEEEETTEEEEEcccTTTTccTTcEEcGGGcEE:Sec Str :============================================================:RP:SCP|15->798|1a8iA|0.0|41.9|775/813|c.87.1.4 :============================================================:BL:SWS|15->797|PHSG_BACSU|0.0|47.6|781/798 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|113->160,296->684|PF00343|e-120|52.8|436/455|Phosphorylase 181: . * . . . .: 240 :VRLGGKVYLVDRGNYLEPVYEDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK:Sequence :EEEccEEEEccccTTEEEEEEccEEEEEEEEEEEEEccccccEEEEEEEEEEccccTccc:Sec Str :============================================================:RP:SCP|15->798|1a8iA|0.0|41.9|775/813|c.87.1.4 :============================================================:BL:SWS|15->797|PHSG_BACSU|0.0|47.6|781/798 241: + . . . . *: 300 :YRTIEQRREVEDLVSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKKYNKSMNKIG:Sequence :cTHHHHHHHHHTTTTccccccccHHccHHHHHHHHHHHHHHHHHHHHHHHcccccGGGHH:Sec Str :============================================================:RP:SCP|15->798|1a8iA|0.0|41.9|775/813|c.87.1.4 :============================================================:BL:SWS|15->797|PHSG_BACSU|0.0|47.6|781/798 : $$$$$:RP:PFM|113->160,296->684|PF00343|e-120|52.8|436/455|Phosphorylase 301: . . . . + .: 360 :EYIGIHINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVH:Sequence :HHEEEEEEccTTTTHHHHHHHHHHTTccccHHHHHHHHHHHEEEEcccccTTcccEEEHH:Sec Str :============================================================:RP:SCP|15->798|1a8iA|0.0|41.9|775/813|c.87.1.4 :============================================================:BL:SWS|15->797|PHSG_BACSU|0.0|47.6|781/798 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|113->160,296->684|PF00343|e-120|52.8|436/455|Phosphorylase 361: . . . * . .: 420 :IMQQVQPRILQIIQEIDRRFVEEKQGKYARDMIERTRIIKDNQVRMANLSIIGSHSTNGV:Sequence :HHHHHcHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccEEccEEEHHHHHHHHccEEEEc:Sec Str :============================================================:RP:SCP|15->798|1a8iA|0.0|41.9|775/813|c.87.1.4 :============================================================:BL:SWS|15->797|PHSG_BACSU|0.0|47.6|781/798 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|113->160,296->684|PF00343|e-120|52.8|436/455|Phosphorylase 421: . . + . . .: 480 :AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP:Sequence :cHHHHHHHHHTTTHHHHHHcGGGEEEccccccTccccccTcHHHHHHHHHHHccGGGGcG:Sec Str :============================================================:RP:SCP|15->798|1a8iA|0.0|41.9|775/813|c.87.1.4 :============================================================:BL:SWS|15->797|PHSG_BACSU|0.0|47.6|781/798 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|113->160,296->684|PF00343|e-120|52.8|436/455|Phosphorylase 481: . * . . . .: 540 :TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR:Sequence :GGGGGGGGGTTcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccTTcEEEEEEccccGGGT:Sec Str :============================================================:RP:SCP|15->798|1a8iA|0.0|41.9|775/813|c.87.1.4 :============================================================:BL:SWS|15->797|PHSG_BACSU|0.0|47.6|781/798 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|113->160,296->684|PF00343|e-120|52.8|436/455|Phosphorylase 541: + . . . . *: 600 :QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGAKAAPSYYYAKAIIKCINEVANMVNNDP:Sequence :HHHHHHHHHHHHHHHHHcTTTcccccEEEEEEccccTTcHHHHHHHHHHHHHHHHHTTcT:Sec Str : XXXXXXXXXXXXXXX :SEG|573->587|akaapsyyyakaiik :============================================================:RP:SCP|15->798|1a8iA|0.0|41.9|775/813|c.87.1.4 :============================================================:BL:SWS|15->797|PHSG_BACSU|0.0|47.6|781/798 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|113->160,296->684|PF00343|e-120|52.8|436/455|Phosphorylase 601: . . . . + .: 660 :EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG:Sequence :TTTTcEEEEEETTccHHHHHHHcTTccEEEEcccTTccccccHHHHHHHTTcEEEEcccT:Sec Str : ############# :PROS|638->650|PS00102|PHOSPHORYLASE|PDOC00095| :============================================================:RP:SCP|15->798|1a8iA|0.0|41.9|775/813|c.87.1.4 :============================================================:BL:SWS|15->797|PHSG_BACSU|0.0|47.6|781/798 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|113->160,296->684|PF00343|e-120|52.8|436/455|Phosphorylase 661: . . . * . .: 720 :ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNC:Sequence :HHHHHHHHHcGGGcEEccccHHHHHHHHHHccccHHHHHHHcHHHHHHHHHHHHTTTccc:Sec Str :============================================================:RP:SCP|15->798|1a8iA|0.0|41.9|775/813|c.87.1.4 :============================================================:BL:SWS|15->797|PHSG_BACSU|0.0|47.6|781/798 :$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|113->160,296->684|PF00343|e-120|52.8|436/455|Phosphorylase 721: . . + . . .: 780 :QAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSS:Sequence :cTTTTHHHHHHHHHccTTcHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHTTcGGGcH:Sec Str :============================================================:RP:SCP|15->798|1a8iA|0.0|41.9|775/813|c.87.1.4 :============================================================:BL:SWS|15->797|PHSG_BACSU|0.0|47.6|781/798 781: . * . . . .: 840 :DDTIKRYAEDIWNISPLKDEKHGTYSL :Sequence :HHHHHHHHHHTTccccccccc :Sec Str :================== :RP:SCP|15->798|1a8iA|0.0|41.9|775/813|c.87.1.4 :================= :BL:SWS|15->797|PHSG_BACSU|0.0|47.6|781/798