[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:gpmA.2"

gpmA        "2,3-bisphosphoglycerate-dependent phosphoglycerate mutase"
            ""

OrgPattern ------------------------------------------111-111-111--------------- --11211111111111111-11111111111111111211111211111211111211111111111111112222221--1--11111122-111----1-----1---11111111111111111111111111-11-----1-121--------1-11-----2--1---1-------1----11--1---111111211112111------111111----344333-1-1111111111111111111133233232222233332433442221111111222211121121111111111111111211121111211-23---1----1-11221---22-1--111111-11-----112-111---11131111111111111-1--111111111111-2412421211111--12211111111111-----------------------11------------------------------111111211111111111111111111111111121111122212112211111123-----1-11111112221211-1--1-1-1-111-1-1-11-------1--1----------------------111-----1-1--1---------------------1-1111-11111111111111111111111-11111111111111111111111112111111111111111111111111111111111111111111-----------1---222212111111111-----------------------------------------------------11111111111111---1------1111111111----------------------------1-------1-1 1-11111-1------11----------------------------------1-1--------13232212232224423432222211---11-------151-----E2-4564434252243352649U6-34D23433236323335342433233221121117241-----11-------3113-21772322H -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPKLVFIRHGQSEWNLKNLFTGWEDVNLSEKGVEEAKEAGRKLKEAGIEFDQAYTSVLTR:Sequence :cEEEEEEEEcccHHHHTTcccTTccccccHHHHHHHHHHHHHHHHTTccccEEEEcccHH:Sec Str : ===========================================================:RP:SCP|2->223|1bq3A|2e-76|53.2|222/234|c.60.1.1 :============================================================:BL:SWS|1->228|GPMA2_LACSS|e-109|81.6|228/229 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->189|PF00300|2e-27|45.2|157/158|PGAM 61: . . . * . .: 120 :AIKTLHFALEESGQLWIPEMKTWRLNERHYGALQGKNKAAAAEKYGDEQVHIWRRSYDVL:Sequence :HHHHHHHHHHHHTcTTccEEEcGGGcccccGGGTTccHHHHHHHHcHHHHHHHHHcTTcc:Sec Str :============================================================:RP:SCP|2->223|1bq3A|2e-76|53.2|222/234|c.60.1.1 :============================================================:BL:SWS|1->228|GPMA2_LACSS|e-109|81.6|228/229 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->189|PF00300|2e-27|45.2|157/158|PGAM 121: . . + . . .: 180 :PPLLSADDEGSAANDRRYADLDPRIIPGGENLKVTLERVIPFWEDHIAPDLLAGKNVIVA:Sequence :cccccTTcTTcGGGcGGGTTccTTTccccccHHHHHHHHHHHHHHTHHHHHHTTccEEEE:Sec Str :============================================================:RP:SCP|2->223|1bq3A|2e-76|53.2|222/234|c.60.1.1 :============================================================:BL:SWS|1->228|GPMA2_LACSS|e-109|81.6|228/229 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->189|PF00300|2e-27|45.2|157/158|PGAM 181: . * . . . .: 240 :AHGNSLRALTKYIEQISDEDIMNVEMATGQPVVYDLDDKLNIVNKEKL :Sequence :EcHHHHHHHHHHHTTccHHHHHHccccTTccEEEEEcTTccEEEEEEc :Sec Str :=========================================== :RP:SCP|2->223|1bq3A|2e-76|53.2|222/234|c.60.1.1 :================================================ :BL:SWS|1->228|GPMA2_LACSS|e-109|81.6|228/229 :$$$$$$$$$ :RP:PFM|4->189|PF00300|2e-27|45.2|157/158|PGAM