[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:metC"

metC        "Cystathionine beta-lyase / Cystathionine gamma-lyase"
            ""

OrgPattern 22-1-11111111111-111111-3332233321--------1451-1-1221-111-1--2221--- 1741421233222144433-34223533333244443567133365423442446566--324-433334345554441-131-----33222211---11435442344---------------2323322431144444---43---2--1--11332331----2-1-33323333323334322--12435555555555555556633435553453511333333752333333333333323334422-11113-1-331112-1-253323-------222122221211111111111112111222333222-241573333333231227721113241-6333-22--1-242343321317-33335-----35867543C567544444443446167766846783-555666665866443543434544345222222224222335811-----------------------11112346424643463344754444333844441453465441143343555745665323111343222222222244221123-2-241----565354423445442113231122212112111111123121113332314434335455444444544355442--3321------52332332222222222-2222222232222222223333334462222222222222222422222222-32233333333322-311111111112214333334-22212223333332312231333344251656424221--------12223222222332233232333331111113122--11--------1----------------------------11--22222-32 ----112-631-675566566768786554534464654544554555675AA86655555555654435535557834665555543-67464493222333544-4724151121111111122111372-2131121111211111111111111211134241112233423235n4443465696644342225 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKFETKLIHGGQSEDQATGAVSISVYRSSTFHQYELGGNPKWEYSRTGNPTRAALEALIA:Sequence :ccHHHHHHHTTccccTTTcccccccccccccccccHHHcccHHccccccHHHHHHHHHHH:Sec Str : ===========================================================:RP:SCP|2->380|1cs1A|1e-75|37.7|379/384|c.67.1.3 : =========================================================:BL:SWS|4->378|METC_LACLM|e-121|57.3|375/380 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->376|PF01053|1e-97|51.6|368/384|Cys_Met_Meta_PP 61: . . . * . .: 120 :DLEGGVAGFAFASGSAAIHATFSMYSAHDHFIVGSDVYGGTFRLINKVLKRFGLEFTVVD:Sequence :HHHTccEEEEEccHHHHHHHHHTTccTTcEEEEEccccHHHHHHHHHHHHHHccEEEEEc:Sec Str : XXXXXXXXXXX :SEG|67->77|agfafasgsaa :============================================================:RP:SCP|2->380|1cs1A|1e-75|37.7|379/384|c.67.1.3 :============================================================:BL:SWS|4->378|METC_LACLM|e-121|57.3|375/380 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->376|PF01053|1e-97|51.6|368/384|Cys_Met_Meta_PP 121: . . + . . .: 180 :IQDLAAVENAIQDNTVAIYFETPTNPLLQIADIAAITKIAKKHKLKTIVDNTFATPYNQR:Sequence :TTcHHHHHHHccTTEEEEEEEcccTTTcccccHHHHHHHHHHTTcEEEEEcccccTTTcc:Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|150->168|iadiaaitkiakkhklkti :============================================================:RP:SCP|2->380|1cs1A|1e-75|37.7|379/384|c.67.1.3 :============================================================:BL:SWS|4->378|METC_LACLM|e-121|57.3|375/380 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->376|PF01053|1e-97|51.6|368/384|Cys_Met_Meta_PP 181: . * . . . .: 240 :PLELGADIVVHSATKYLGGHSDVVAGLAVTSDEKIAEKLAFLQNSIGSTLGPDDSWLIQR:Sequence :GGGGTccEEEEETTTTTTcccccccEEEEEcccHHHHHHHHHHHHHcccccHHHHHHHHH:Sec Str : ############### :PROS|187->201|PS00868|CYS_MET_METAB_PP|PDOC00677| :============================================================:RP:SCP|2->380|1cs1A|1e-75|37.7|379/384|c.67.1.3 :============================================================:BL:SWS|4->378|METC_LACLM|e-121|57.3|375/380 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->376|PF01053|1e-97|51.6|368/384|Cys_Met_Meta_PP 241: + . . . . *: 300 :GIKTLGARMRVHHANTEAIIKFLENDDRVARILYPGLPDFPGHEVAKKQMDHFGAMISFE:Sequence :HHTTHHHHHHHHHHHHHHHHHHHHTcTTEEEEEcTTcTTcTTHHHHHHHccccccEEEEE:Sec Str :============================================================:RP:SCP|2->380|1cs1A|1e-75|37.7|379/384|c.67.1.3 :============================================================:BL:SWS|4->378|METC_LACLM|e-121|57.3|375/380 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->376|PF01053|1e-97|51.6|368/384|Cys_Met_Meta_PP 301: . . . . + .: 360 :LQEGLDTKKFVESLKVISLAESLGGIESLIEVPSVMTHGSIPREIRLENGIKDELIRLSV:Sequence :ETTHHHHHHHHHHccccEEcccccccccEEEcTTTTTTcccccTTTTTccccccEEEEEc:Sec Str :============================================================:RP:SCP|2->380|1cs1A|1e-75|37.7|379/384|c.67.1.3 :============================================================:BL:SWS|4->378|METC_LACLM|e-121|57.3|375/380 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->376|PF01053|1e-97|51.6|368/384|Cys_Met_Meta_PP 361: . . . * . .: 420 :GIEDEEDLINDLKQALDKIG :Sequence :ccccHHHHHHHHTTcHHHHc :Sec Str :==================== :RP:SCP|2->380|1cs1A|1e-75|37.7|379/384|c.67.1.3 :================== :BL:SWS|4->378|METC_LACLM|e-121|57.3|375/380 :$$$$$$$$$$$$$$$$ :RP:PFM|8->376|PF01053|1e-97|51.6|368/384|Cys_Met_Meta_PP