[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:napA.1"

napA        "Na+/H+ antiporter"
            ""

OrgPattern -------------------------------------1-----------1-----1--1--------- ----1-------1----------------------------------------------------------1-----------1-------------------------------------------------------1----------------------------------------------11----11111111111111111--11111111-1----------1-111111-1111111111111-1-1111111111111111---1---111----------------------------------------1---1-1111111-11----1111-1---1----------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSVSFLIVTLAAFITPMVLARFKVSFLPTSVAEIIIGIIIGKSCFNLIHADTLLSWCSTF:Sequence : :Sec Str : XXXXXXXX :SEG|34->41|iiigiiig : ================================================:BL:SWS|13->602|YJBQ_BACSU|2e-79|32.1|579/614 : $:RP:PFM|60->332|PF00999|4e-14|27.1|255/379|Na_H_Exchanger 61: . . . * . .: 120 :GVILLMFLSGMEIDFSLFKKNSHTLSPLEAKMAANEPKTSPVRAATYAYAFSLVASLILA:Sequence : :Sec Str :============================================================:BL:SWS|13->602|YJBQ_BACSU|2e-79|32.1|579/614 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|60->332|PF00999|4e-14|27.1|255/379|Na_H_Exchanger 121: . . + . . .: 180 :LLFKVTGLFSDVGLATILFSTVSLGIMTSLLKENELLSRPFGQTILLFSVLGEVIPMIAL:Sequence : :Sec Str :============================================================:BL:SWS|13->602|YJBQ_BACSU|2e-79|32.1|579/614 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|60->332|PF00999|4e-14|27.1|255/379|Na_H_Exchanger 181: . * . . . .: 240 :TAYSSIYAGKGASLWLITLLFIAAAFLFNRFRHFFSFFDKINKATTQIDMRLAFFVIIAL:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|199->218|llfiaaaflfnrfrhffsff :============================================================:BL:SWS|13->602|YJBQ_BACSU|2e-79|32.1|579/614 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|60->332|PF00999|4e-14|27.1|255/379|Na_H_Exchanger 241: + . . . . *: 300 :VLVAETVGAENILGAFVAGIVLKLLEPAEETEHRLDAIGYGFFTPFFFILTGVNLDIPSL:Sequence : :Sec Str :============================================================:BL:SWS|13->602|YJBQ_BACSU|2e-79|32.1|579/614 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|60->332|PF00999|4e-14|27.1|255/379|Na_H_Exchanger 301: . . . . + .: 360 :MRSPKTLLLIPLFFVAFILAKLPGYFGFQRRFSKKNSFVGAVATSTTITLVVTTLKIAEH:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXX :SEG|341->358|avatsttitlvvttlkia :============================================================:BL:SWS|13->602|YJBQ_BACSU|2e-79|32.1|579/614 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|60->332|PF00999|4e-14|27.1|255/379|Na_H_Exchanger 361: . . . * . .: 420 :LHAITPQQSGAFLLAGILTCIVGPVFFNKQYKPEPEDQKQTSLHIIGVNLVTVSAAQQLS:Sequence : EEcccHHHHHHHHHTT:Sec Str :============================================================:BL:SWS|13->602|YJBQ_BACSU|2e-79|32.1|579/614 421: . . + . . .: 480 :KGMYDVQMYTDNSKNFTTYNSQANVHFLDSLDPDELIANHIFDTDILVLGYADYNVNYKL:Sequence :TccEEEEEEccGGGHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : =======================================:RP:SCP|442->514|1hkuA2|3e-04|19.1|68/138|c.23.12.1 :============================================================:BL:SWS|13->602|YJBQ_BACSU|2e-79|32.1|579/614 481: . * . . . .: 540 :SLAAKKYGVNRVIVRFENRNPLNDMEDELKKAGIEYFSYFDINVGMMRSMIDSPSMLQIL:Sequence :HHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHcccEEEE:Sec Str :================================== :RP:SCP|442->514|1hkuA2|3e-04|19.1|68/138|c.23.12.1 : =======:RP:SCP|534->616|1vctA2|5e-09|16.9|83/94|d.286.1.1 :============================================================:BL:SWS|13->602|YJBQ_BACSU|2e-79|32.1|579/614 541: + . . . . *: 600 :TSSESRLYEVVVNDSIFVGVEVKDLPHIDKITISRIYRNGHAIAPHGYTQLQLGDHIIFS:Sequence :EcccEEEEEEccTTcTTTTccHHHHHHHHccEEEEEEETTEEEcccTTccccTTcEEEEE:Sec Str :============================================================:RP:SCP|534->616|1vctA2|5e-09|16.9|83/94|d.286.1.1 :============================================================:BL:SWS|13->602|YJBQ_BACSU|2e-79|32.1|579/614 601: . . . . + .: 660 :ASAEESAYFRRKLQRRNE :Sequence :EcHHHHHHHHHHHTTccc :Sec Str :================ :RP:SCP|534->616|1vctA2|5e-09|16.9|83/94|d.286.1.1 :== :BL:SWS|13->602|YJBQ_BACSU|2e-79|32.1|579/614