[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:nusA"

nusA        "N utilization substance protein A"
            ""

OrgPattern -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---1-111---------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSKELLNALNALEVEKGVKKEIVIEALEAALVSAYKRNYGQAQNVEVEFDKIAGNIHVYA:Sequence : cccccccGGGGGcTTccHHHHHHHcccHHHHHHHHHHHHHcccEEEE:Sec Str : XXXXXXXXXX :SEG|4->13|ellnalnale :============================================================:RP:SCP|1->124|1hh2P4|2e-35|48.4|124/126|d.202.1.1 : ==========================:BL:SWS|35->347|NUSA_BACSU|e-119|65.1|312/371 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->125|PF08529|1e-23|60.4|111/122|NusA_N 61: . . . * . .: 120 :VKEVVNEVYDSQLEISLKSALEINRAYEIGDTIREEVTPKDFGRIAAQTAKQVIMQRVRK:Sequence :ccccHHHHHHHHHTTcEEEEEEEETTTEEEEEEEEEETTEEETEcTTGGGTTHHHHHHHH:Sec Str :============================================================:RP:SCP|1->124|1hh2P4|2e-35|48.4|124/126|d.202.1.1 :============================================================:BL:SWS|35->347|NUSA_BACSU|e-119|65.1|312/371 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->125|PF08529|1e-23|60.4|111/122|NusA_N 121: . . + . . .: 180 :EEREVIYNEYVQYEQEIVTGEVERRDNKFVYVNLGRIEAVLSRQDQIPGEEYKSHDKIKV:Sequence :HHHHHHTTccccTTTcEEEEEEEccHHHHHTTcEEcEEEEEcGGGccTTccccTTcEEEE:Sec Str :==== :RP:SCP|1->124|1hh2P4|2e-35|48.4|124/126|d.202.1.1 : =================================================:RP:SCP|132->198|1k0rA1|4e-17|31.3|67/76|b.40.4.5 :============================================================:BL:SWS|35->347|NUSA_BACSU|e-119|65.1|312/371 :$$$$$ :RP:PFM|15->125|PF08529|1e-23|60.4|111/122|NusA_N 181: . * . . . .: 240 :YIYKVENTSKGPQVFVSRSHPDLLRRLFEQEIPEIFDGTVEIVSISREAGDRAKVAVRSN:Sequence :EEEEEEccccccEEEEEcccHHHHHHHHHHHcHHHHHTcEEEEEEEEETTTEEEEEEEEc:Sec Str :================== :RP:SCP|132->198|1k0rA1|4e-17|31.3|67/76|b.40.4.5 : =========================================:RP:SCP|200->275|1hh2P2|3e-19|50.0|76/78|d.52.3.1 :============================================================:BL:SWS|35->347|NUSA_BACSU|e-119|65.1|312/371 241: + . . . . *: 300 :EDGVDPVGTCVGPRGERVQAIVNELKGENMDIVEWREDPAEYIANALNPAKVLDVRFDDE:Sequence :cTTccHHHHHHcGGGGHHHHHHHHHHccEEEEEEccccHHHHHHHHcTTccEEEEEEEET:Sec Str :=================================== :RP:SCP|200->275|1hh2P2|3e-19|50.0|76/78|d.52.3.1 : ========================:RP:SCP|277->343|1hh2P3|1e-11|59.7|67/68|d.52.3.1 :============================================================:BL:SWS|35->347|NUSA_BACSU|e-119|65.1|312/371 301: . . . . + .: 360 :NEHACTVVVPDDQLSLAIGKRGQNARLAARLTGYKIDIKSESDAADLNNVEADNNDIDDE:Sequence :TEEEEEEEEcTTTHHHHHcGGGHHHHHHHHHHHHHHcEEEcccccccccHHHHHHHHHHH:Sec Str :=========================================== :RP:SCP|277->343|1hh2P3|1e-11|59.7|67/68|d.52.3.1 :=============================================== :BL:SWS|35->347|NUSA_BACSU|e-119|65.1|312/371 361: . . . * . .: 420 :DQLMSDSSSNIIEEE :Sequence :HHHHHHc :Sec Str