[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99378.1 lsal0 nusA "N utilization substance protein A"
MSKELLNALNALEVEKGVKKEIVIEALEAALVSAYKRNYGQAQNVEVEFDKIAGNIHVYA
VKEVVNEVYDSQLEISLKSALEINRAYEIGDTIREEVTPKDFGRIAAQTAKQVIMQRVRK
EEREVIYNEYVQYEQEIVTGEVERRDNKFVYVNLGRIEAVLSRQDQIPGEEYKSHDKIKV
YIYKVENTSKGPQVFVSRSHPDLLRRLFEQEIPEIFDGTVEIVSISREAGDRAKVAVRSN
EDGVDPVGTCVGPRGERVQAIVNELKGENMDIVEWREDPAEYIANALNPAKVLDVRFDDE
NEHACTVVVPDDQLSLAIGKRGQNARLAARLTGYKIDIKSESDAADLNNVEADNNDIDDE
DQLMSDSSSNIIEEE
//