[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:oppC"

oppC        "Oligopeptide transport system permease protein"
            ""

OrgPattern 4441313244444443333332113336425212---1-----113-52-DA5-54433133213-11 1114D443344-4113322-2311292222224333276816286DA4344379732411552385677A33222722323-411111--------2--------11--122222222222222211111111121466952216A33223332222------32115322--11-11---11A5433781423666664564546445A76663655324C521222222E6155555555655556333222222331-12111--33111112234333333311112211111112222222222222231133211111C36244434541422222111153153C-111BA631-282-3362174311----1121132HHP115854B1AAAAA997AAL-44C43A4DQO1-mRRWIIEWTLOPK4-115BDA6AA6CC1111111123322219--------------------------------1-1CFCBC68878654555559955552566E64A7113342353343C5DR241132242-------111211346132352233331111111211----14111111------112212221113-1211553121111151111111111111111121--13321------76JD4977777777777-7777777777777777776ABACA3366666666666656566877667574-666666666666--111-1-1111111747333-2222221312322222121234233233658255442ABA1----1---256666666656688--1-------------12111111111111117-111211-222212122212212111143754AEA88212 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2------1--1---1-------1------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEEKLKLSPDSFEPLAKGEAQDNEKIAAPSLTFTQDVWLRLKKNKGAVVSLIVILLMVIV:Sequence : XXXXXXXXXXXXX:SEG|48->60|vvslivillmviv : =================================================:BL:SWS|12->342|OPPC_BACSU|9e-55|46.8|297/305 61: . . . * . .: 120 :AFGSTPFINKSTLVKSQPQYANLPAKVPGLDAINGLNGKIKQGGVWVDAYAKNDVPKDKY:Sequence : ===:RP:SCP|118->336|2r6gG1|4e-27|10.6|217/284|f.58.1.1 :============================================================:BL:SWS|12->342|OPPC_BACSU|9e-55|46.8|297/305 121: . . + . . .: 180 :FYLGTDYLGRSLAQRIIYGTKVSLIVALVATFFDLTVGVAYGIISGWKGGRVDNVMQRII:Sequence :============================================================:RP:SCP|118->336|2r6gG1|4e-27|10.6|217/284|f.58.1.1 :============================================================:BL:SWS|12->342|OPPC_BACSU|9e-55|46.8|297/305 181: . * . . . .: 240 :EIISSIPNLVIVVLMLVVLKPGMTSIILAIAISSWTTMARMIRAETLSLKTQEYVLAART:Sequence : XXXXXXXXXXX :SEG|189->199|lvivvlmlvvl :============================================================:RP:SCP|118->336|2r6gG1|4e-27|10.6|217/284|f.58.1.1 :============================================================:BL:SWS|12->342|OPPC_BACSU|9e-55|46.8|297/305 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|202->341|PF00528|2e-04|27.1|133/195|BPD_transp_1 241: + . . . . *: 300 :LGESPTKIAWKHLVPNLSSIIIIQTMYTIPSAIFFEAFLSFIGIGITAPETSLGVLLNEG:Sequence :============================================================:RP:SCP|118->336|2r6gG1|4e-27|10.6|217/284|f.58.1.1 :============================================================:BL:SWS|12->342|OPPC_BACSU|9e-55|46.8|297/305 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|202->341|PF00528|2e-04|27.1|133/195|BPD_transp_1 301: . . . . + .: 360 :QKNFQFLPYQMWYPAIVLCVLMIAFNLLGDGLRDAFDPKTRR :Sequence :==================================== :RP:SCP|118->336|2r6gG1|4e-27|10.6|217/284|f.58.1.1 :========================================== :BL:SWS|12->342|OPPC_BACSU|9e-55|46.8|297/305 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|202->341|PF00528|2e-04|27.1|133/195|BPD_transp_1