[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE00499.1 lsal0 oppC "Oligopeptide transport system permease protein"
MEEKLKLSPDSFEPLAKGEAQDNEKIAAPSLTFTQDVWLRLKKNKGAVVSLIVILLMVIV
AFGSTPFINKSTLVKSQPQYANLPAKVPGLDAINGLNGKIKQGGVWVDAYAKNDVPKDKY
FYLGTDYLGRSLAQRIIYGTKVSLIVALVATFFDLTVGVAYGIISGWKGGRVDNVMQRII
EIISSIPNLVIVVLMLVVLKPGMTSIILAIAISSWTTMARMIRAETLSLKTQEYVLAART
LGESPTKIAWKHLVPNLSSIIIIQTMYTIPSAIFFEAFLSFIGIGITAPETSLGVLLNEG
QKNFQFLPYQMWYPAIVLCVLMIAFNLLGDGLRDAFDPKTRR
//