[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:proC"

proC        "Pyrroline-5-carboxylate reductase"
            ""

OrgPattern 11-1-11-1111111111-1-------111-11-1-----------1--1111--1-11111111--- 11-1111111111111111-1111111111111111111111111-11111111111111111111111111111211--11111111112111-------112211111--------------111111111111111111111111111111111111111111121211111111111111111121112343434534345455523443345421211112222123211111111111111111111211-11-1---1122111111111111111111111111111111111111111111111111111111111111111111111112221111211--111111111111-111111--1111-11111-11111111111111111111111111----1-1-1111-511232133221--111-1-111111111111111-1111-11----1111----------------------111121221-1111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111-1111-111111111-1-----1-111111111111-111111111112111112111111--11111------11211111111111111-11111111111111111111211111111111111111111111111111111111111111111--1111111111111111111111-1111111122222111111111111111121111111111111111111111111111111111111111111111111111111---------1-----1---------------------11--11111111 11-1222-311-111223242215333111111-11111111-111332333632121211111111111111111111111111111-12121111111111212-13144533321111133432B3GY4-8571313333321322-31133222123312122325A22312112G1112211212112121112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEK:Sequence :cEEEEEcccHHHHHHHHHTTccccEEEEEEEEcccHHHHHHHHHHHTccccccHHHHHTT:Sec Str : ===========================================================:RP:SCP|2->161|2ahrA2|8e-28|31.8|151/152|c.2.1.6 :============================================================:BL:SWS|1->263|P5CR_AQUAE|5e-42|38.7|256/265 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->85|PF03807|5e-10|41.7|84/96|F420_oxidored 61: . . . * . .: 120 :SDVVFLAVKPIVVEKVLKEVKDSVLTHDPVLVSVVTGVSVAELEDILGSKDVKIVRTMPN:Sequence :ccEEEEcccGGGHHHHHTTccccccEEEccTccHcccccGGHHHHHHHcTTccEEEEccG:Sec Str : XXXXXXXXXXX :SEG|90->100|vlvsvvtgvsv :============================================================:RP:SCP|2->161|2ahrA2|8e-28|31.8|151/152|c.2.1.6 :============================================================:BL:SWS|1->263|P5CR_AQUAE|5e-42|38.7|256/265 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|2->85|PF03807|5e-10|41.7|84/96|F420_oxidored 121: . . + . . .: 180 :VNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFVYF:Sequence :GGGTcEEEEEEEcTTccccHHHHHHHHHHHHTcEEEEEccGGGHHHHHHHTTTHHHHHHH:Sec Str :========================================= :RP:SCP|2->161|2ahrA2|8e-28|31.8|151/152|c.2.1.6 : =====================:RP:SCP|160->261|1yqgA1|1e-28|22.5|102/111|a.100.1.10 :============================================================:BL:SWS|1->263|P5CR_AQUAE|5e-42|38.7|256/265 181: . * . . . .: 240 :FIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVAGLL:Sequence :HHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccTTcHHHHHHH:Sec Str : ####################:PROS|221->243|PS00521|P5CR|PDOC00451| :============================================================:RP:SCP|160->261|1yqgA1|1e-28|22.5|102/111|a.100.1.10 :============================================================:BL:SWS|1->263|P5CR_AQUAE|5e-42|38.7|256/265 241: + . . . . *: 300 :AMEEAGFMTSIVKGVDATISKDKG :Sequence :HHHHHTHHHHHHHHHHHHHHHHH :Sec Str :### :PROS|221->243|PS00521|P5CR|PDOC00451| :===================== :RP:SCP|160->261|1yqgA1|1e-28|22.5|102/111|a.100.1.10 :======================= :BL:SWS|1->263|P5CR_AQUAE|5e-42|38.7|256/265