[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:rbsK"

rbsK        "Ribokinase"
            ""

OrgPattern 112-21211111112221111111---11---1132-1-11------------11111111---1--1 1-2-121122211111111-11---111111-1111121112--121----1212--1--1132-321131111121231-12-----1131-3-----111-11-13-1---------------11---111-1122112---21122211-11-----1-----222221---11------132---1-2222222221112212115333242211243333-2222134232333333333333223222321112323323221121213322111111-1------------------------------------212124444343444723--334433-211-21----1--511134211-31-2111------1-212---2----1111111-113---2--1--14--334432454311--1111423132321--------21111-11-----------------------------1----------4444433111133353333235341111--112--1----2-13----1--11--------------2--1-1---1-------1--1-------111---------------------------2252---12-2-111111211111131122-------------4311132655A68A856-56667796C858666666653511344645676666676666726646665--233333312333-1-1-----1-1-1-224332322-21112222-----11---1-11211223-2221-11321111211112222323322111211222222221111---211--11-----1-1--2----2-----1-----1--------1221-132222-- ----111-211111111111222212211----1111111111----11122222211111111111111111111111111111111-1-1111111111111-1-1412111111111111111111371-1121-112111-1111111111111211-1113131111131-111-32122B5781972132231 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSNKVTVLGSLNVDTILRIPRLPQPGETLKMDDIGVAGGGKGANQAISAARSKSHVTFIG:Sequence :ccEEEEEEcccEEEEEEEccccccTTcccccccEEEEEEcHHHHHHHHHHHTTcEEEEEc:Sec Str : =========================================================:RP:SCP|4->304|2fv7A1|2e-75|35.5|301/308|c.72.1.1 : ===========================================================:BL:SWS|2->305|RBSK_ECOLI|1e-56|40.7|302/309 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->290|PF00294|6e-35|36.5|277/295|PfkB 61: . . . * . .: 120 :GVGNDVQGEMMLKLLKEDGININNVAKLNEGTGQAFILLQESGENSIVIYGGANQAIKTT:Sequence :EEcTTTTTcHHHHHHHHTTcccTTcEEccccccEEEEEEcccccEEccEEcGGGGGGGGc:Sec Str :============================================================:RP:SCP|4->304|2fv7A1|2e-75|35.5|301/308|c.72.1.1 :============================================================:BL:SWS|2->305|RBSK_ECOLI|1e-56|40.7|302/309 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->290|PF00294|6e-35|36.5|277/295|PfkB 121: . . + . . .: 180 :VIQNAMNDIKDSDFLVAQFETPLEVTNEAFKLARELNVKTILNPAPATDILDELKKNIDL:Sequence :ccccccEEEEEEEEccccHHHHHHHHHHHcTTcEEEEccGGGGGGccHHHHHHHHHTccE:Sec Str :============================================================:RP:SCP|4->304|2fv7A1|2e-75|35.5|301/308|c.72.1.1 :============================================================:BL:SWS|2->305|RBSK_ECOLI|1e-56|40.7|302/309 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->290|PF00294|6e-35|36.5|277/295|PfkB 181: . * . . . .: 240 :IIPNETEAELLTGIKVVDEDTCRQAADKLIDQGINNVIITLGKQGAYYKTKDGVCELVPA:Sequence :EEEEHHHHHHHHHcccccTTHHHTccHHHHHTTccEEEEEcGGGcEEEEccccEEEEccc:Sec Str :============================================================:RP:SCP|4->304|2fv7A1|2e-75|35.5|301/308|c.72.1.1 :============================================================:BL:SWS|2->305|RBSK_ECOLI|1e-56|40.7|302/309 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->290|PF00294|6e-35|36.5|277/295|PfkB 241: + . . . . *: 300 :FKVKAIDTTAAGDTFIGALVSKLDTSFSNLREAIIYASKASSLAVQRLGAIPSIPYKDDV:Sequence :ccccccccTTHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHTTcccccTTcccHHHH:Sec Str : ############## :PROS|247->260|PS00584|PFKB_KINASES_2|PDOC00504| :============================================================:RP:SCP|4->304|2fv7A1|2e-75|35.5|301/308|c.72.1.1 :============================================================:BL:SWS|2->305|RBSK_ECOLI|1e-56|40.7|302/309 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|7->290|PF00294|6e-35|36.5|277/295|PfkB 301: . . . . + .: 360 :EKQLNSK :Sequence :HHHHHHE :Sec Str :==== :RP:SCP|4->304|2fv7A1|2e-75|35.5|301/308|c.72.1.1 :===== :BL:SWS|2->305|RBSK_ECOLI|1e-56|40.7|302/309