[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:rluD.1"

rluD        "Ribosomal large subunit pseudouridine synthase D"
            ""

OrgPattern --------------------------------------11111------------------------- 2121111222221211111-11111111111111112211111111221111111211111111211121111111112111111222444414-311122223234424-2222222-211114111111111112222211131223233311222222213212222113111113111133311221433-3333333333333322333333333333223333334533333333333333333333-34344343334444444443333333333333333333333333333333333333333334333333332333333333333343333333334332342133141121213323133214333322222333223333333322222222223-3233333322322332222222223344333333333333333333333333342222222223311222222222222221222333332222222232222222222222222222222222322243424334433333322244344444422225471324372234221233334433476779724333233333333333333334333322665444647735888879966689-A888A2-3232322222244444554444444444-44444444444444444444444444544444444444444445444444431544444444444222422222222233625454455454554444444344434436333333333-33333332222222225777566666667664533333333222222443322222223222242211112-22111222222122211122222222222242 ----341-21112231111-11-1-1-111111---1------11111-11111111--1-122222211332222322322222211-2321232111112131-12926222223-111121231214A3-31211112222112-12221322122--2333314222-1112334HA78-36347164A852236 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSDYKVLADKTGRLDKVVTNIFTDYTRSQLKKMIDDGNIKVNGDVKKANYKVNLGDEITF:Sequence :cTTTTTTHHHHHEHHHHHHTTTccccHHHHHHHHHTTcEEETTEEccTTcEEcccccEEE:Sec Str : ================================================:RP:SCP|13->98|1dm9A|3e-13|17.4|86/104|d.66.1.3 : ===================================================:BL:SWS|10->297|YLYB_BACSU|4e-95|58.3|288/303 61: . . . * . .: 120 :DKPEVKKLSLEPENIPLDIVYEDDDVIVVNKPQGMVVHPSPGHFEHTLVNALLYHSPLST:Sequence :TTEEEccccGGGccEEEEEEEEEcccEEEEEcTTcccccccccTTcHHHHHTcccTEEHH:Sec Str : XXXXXXXXXXXX :SEG|78->89|divyedddvivv :====================================== :RP:SCP|13->98|1dm9A|3e-13|17.4|86/104|d.66.1.3 : ===============================:RP:SCP|90->293|1v9kA|3e-60|38.9|198/227|d.265.1.3 :============================================================:BL:SWS|10->297|YLYB_BACSU|4e-95|58.3|288/303 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|90->236|PF00849|1e-30|49.3|140/149|PseudoU_synth_2 121: . . + . . .: 180 :INGTYRPGIVHRIDKDTSGLLMVAKNDMAHQSLAKQLKDKTNTREYVALVHGNIKEDSGT:Sequence :HTTccccEEccccccccEEEEEEEccTHHHHHHHcGGGcccHHEEEEEEEcccccHHHHH:Sec Str : ############### :PROS|130->144|PS01129|PSI_RLU|PDOC00869| :============================================================:RP:SCP|90->293|1v9kA|3e-60|38.9|198/227|d.265.1.3 :============================================================:BL:SWS|10->297|YLYB_BACSU|4e-95|58.3|288/303 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|90->236|PF00849|1e-30|49.3|140/149|PseudoU_synth_2 181: . * . . . .: 240 :IDAPLGRSKVDRKKQAVVKDGRNAVTHFEVLKRYGDYTLVKCVLETGRTHQIRVHMKYIG:Sequence :HHHTccccccHHHHTcccccccccccEEEcEEEEccccEEEEEEccccTTHHHHHHHHTT:Sec Str :============================================================:RP:SCP|90->293|1v9kA|3e-60|38.9|198/227|d.265.1.3 :============================================================:BL:SWS|10->297|YLYB_BACSU|4e-95|58.3|288/303 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|90->236|PF00849|1e-30|49.3|140/149|PseudoU_synth_2 241: + . . . . *: 300 :HPLVGDQLYGPRKTLGNSGQFLHAEKLGFVHPRTNEYLEFTAPLPENFKKLLESLDKR :Sequence :ccEEEEEEEEETEcTEETTEEcTTccTTcEEEccHHHHHHHHHTccccccccTTccEE :Sec Str :===================================================== :RP:SCP|90->293|1v9kA|3e-60|38.9|198/227|d.265.1.3 :========================================================= :BL:SWS|10->297|YLYB_BACSU|4e-95|58.3|288/303