[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99636.1 lsal0 rluD.1 "Ribosomal large subunit pseudouridine synthase D"
MSDYKVLADKTGRLDKVVTNIFTDYTRSQLKKMIDDGNIKVNGDVKKANYKVNLGDEITF
DKPEVKKLSLEPENIPLDIVYEDDDVIVVNKPQGMVVHPSPGHFEHTLVNALLYHSPLST
INGTYRPGIVHRIDKDTSGLLMVAKNDMAHQSLAKQLKDKTNTREYVALVHGNIKEDSGT
IDAPLGRSKVDRKKQAVVKDGRNAVTHFEVLKRYGDYTLVKCVLETGRTHQIRVHMKYIG
HPLVGDQLYGPRKTLGNSGQFLHAEKLGFVHPRTNEYLEFTAPLPENFKKLLESLDKR
//