[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:rluD.4"

rluD        "Ribosomal large subunit pseudouridine synthase D"
            ""

OrgPattern --------------------------------------11111------------------------- 2121122233321211111-11111211111112123211111111222111111111111112111211111111112111111222334314-211122223234424-2222222-211114111111111112222211131223233311222222223112222112111112111133311221433-3333333333333322333333333333223333334533333333333333333333-34344343334444444443333333334444333333333333334444444443443333444333332333333333333343333333334332332122141121212223132214333322222333222333333222222222223-323333331232233222222222334433333333333222222223223334222222222331122222222222222-222333332222222232222222222222222222222222222243223324322333322244233333322225471424261123221233333432465569624333233333333333333334333322654544637735888879966688-988892-3233322122244444554444444444-44444444444444444444444444544444444334444445444444431544444444444222422222222233625555455454554444444344534436433433333-33333332222222226777566666667664433333333222222444432332223222231211112-22121221111222221122222222222232 -1----2-2-1122211-1-111111-11111-----------11111-11111--1111-121122111222222321221111111-12111-11-1111121-1131422222--11112122111362-21211112222111-11221222122--12333-4222-1122221A867-2111515245521-4 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKFTWNKESDEKMTLKKFLKNKGVSHRTLSSLKKGNGKVLVDGKKRSLSIEVGKGKITLI:Sequence : HHHHcccEEHHHHHHTTTcccHHHHHHHHHTTcEEETTEEccTTcEEcccccEEE:Sec Str : ===================================================:RP:SCP|10->93|1dm9A|4e-07|14.3|84/104|d.66.1.3 : ================================================:BL:SWS|13->291|YJBO_BACSU|6e-50|37.3|276/283 61: . . . * . .: 120 :LPPEKSDENVKMSKEPLDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQK:Sequence :TTEEETccEEETTEEEccccGGGccEEEEEEcTTcccccccccTTcHHHHHTcccccccc:Sec Str :================================= :RP:SCP|10->93|1dm9A|4e-07|14.3|84/104|d.66.1.3 : ==========================================:RP:SCP|79->296|1v9kA|7e-52|33.0|212/227|d.265.1.3 :============================================================:BL:SWS|13->291|YJBO_BACSU|6e-50|37.3|276/283 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|87->237|PF00849|9e-22|46.2|143/149|PseudoU_synth_2 121: . . + . . .: 180 :SKDLVPHVITRLDRDTSGLVLVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGII:Sequence :GGcGEEEEccccccccEEEEEEEccTHHHHHHHcGGGGGcccEEEEEEEcccccHHHHHH:Sec Str : ############### :PROS|129->143|PS01129|PSI_RLU|PDOC00869| :============================================================:RP:SCP|79->296|1v9kA|7e-52|33.0|212/227|d.265.1.3 :============================================================:BL:SWS|13->291|YJBO_BACSU|6e-50|37.3|276/283 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|87->237|PF00849|9e-22|46.2|143/149|PseudoU_synth_2 181: . * . . . .: 240 :DKPLGPRENGIGQMVTDTGKIAKTEYWVREYLGDKATLVECKLHTGRTHQIRAHFSSINH:Sequence :HHTcccccccHHHcccccccccccEEEEccccccTTcEEEEEEccccTTHHHHHHHHTTc:Sec Str :============================================================:RP:SCP|79->296|1v9kA|7e-52|33.0|212/227|d.265.1.3 :============================================================:BL:SWS|13->291|YJBO_BACSU|6e-50|37.3|276/283 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|87->237|PF00849|9e-22|46.2|143/149|PseudoU_synth_2 241: + . . . . *: 300 :ALVGDELYGGRLDWGLERQALHAYQLAYVDPFTQEEKLFKSEMPKDLENLIVRLKN :Sequence :cEEEEEEEEEEHHHEETTEEcTTccTTcEEEccHHHHHHHHHTccccccccHHHHc :Sec Str :======================================================== :RP:SCP|79->296|1v9kA|7e-52|33.0|212/227|d.265.1.3 :=================================================== :BL:SWS|13->291|YJBO_BACSU|6e-50|37.3|276/283