[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE00286.1 lsal0 rluD.4 "Ribosomal large subunit pseudouridine synthase D"
MKFTWNKESDEKMTLKKFLKNKGVSHRTLSSLKKGNGKVLVDGKKRSLSIEVGKGKITLI
LPPEKSDENVKMSKEPLDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQK
SKDLVPHVITRLDRDTSGLVLVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGII
DKPLGPRENGIGQMVTDTGKIAKTEYWVREYLGDKATLVECKLHTGRTHQIRAHFSSINH
ALVGDELYGGRLDWGLERQALHAYQLAYVDPFTQEEKLFKSEMPKDLENLIVRLKN
//