[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:rplE"

rplE        "LSU ribosomal protein L5P"
RL5_LACS1   "RecName: Full=50S ribosomal protein L5;"

OrgPattern 11111111111111111-11111111111111-1-111111111111111111111111111111111 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111112111111111111111111-11111111111111111111111111111111 111111111--1111222222222221221-112222222222--12222222222222222221222-1222213332322212233-12222122221111457--21--------------1--------------------------------------1------1221-1------1-185962631111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVNRLKEKYDNEIVPSLMEKFNYTSIMQAPKVDKIVINMGVGDAVSNAKRLDEAVDELTL:Sequence :cccHHHHHHHTTHHHHHHHTTccccTTTcccEEEEEEEEcccTTTTcHHHHHHHHHHHHH:Sec Str : ###:PROS|58->74|PS00358|RIBOSOMAL_L5|PDOC00309| : ===========================================================:RP:SCP|2->180|1iq4A|3e-72|82.1|179/179|d.77.1.1 :============================================================:BL:SWS|1->180|RL5_LACS1|3e-99|100.0|180/180 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->81|PF00281|2e-13|62.5|56/56|Ribosomal_L5 61: . . . * . .: 120 :IAGQKPVITKAKKSIAGFRLREGMAIGAKVTLRGQRMYEFLDKLVSVSLPRVRDFHGVSK:Sequence :HHTccccccccccccTTTTccccccccEEEEEcHHHHHHHHHHHHHTTTTTcTTcccccT:Sec Str :############## :PROS|58->74|PS00358|RIBOSOMAL_L5|PDOC00309| :============================================================:RP:SCP|2->180|1iq4A|3e-72|82.1|179/179|d.77.1.1 :============================================================:BL:SWS|1->180|RL5_LACS1|3e-99|100.0|180/180 :$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|25->81|PF00281|2e-13|62.5|56/56|Ribosomal_L5 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|86->178|PF00673|2e-33|63.4|93/95|Ribosomal_L5_C 121: . . + . . .: 180 :RAFDGRGNYTLGIREQLIFPEIDFDDVNKVRGMDIVIVTTANTDEESRELLTQLGMPFAK:Sequence :TccccccEEccEEccGGGccccccTTccccccEEEEEEEccccHHHHHHHHHHHTccccc:Sec Str :============================================================:RP:SCP|2->180|1iq4A|3e-72|82.1|179/179|d.77.1.1 :============================================================:BL:SWS|1->180|RL5_LACS1|3e-99|100.0|180/180 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|86->178|PF00673|2e-33|63.4|93/95|Ribosomal_L5_C