[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE00227.1 lsal0 rplE "LSU ribosomal protein L5P"
MVNRLKEKYDNEIVPSLMEKFNYTSIMQAPKVDKIVINMGVGDAVSNAKRLDEAVDELTL
IAGQKPVITKAKKSIAGFRLREGMAIGAKVTLRGQRMYEFLDKLVSVSLPRVRDFHGVSK
RAFDGRGNYTLGIREQLIFPEIDFDDVNKVRGMDIVIVTTANTDEESRELLTQLGMPFAK
//