[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:rplN"

rplN        "LSU ribosomal protein L14P"
RL14_LACS1  "RecName: Full=50S ribosomal protein L14;"

OrgPattern 11111111111111111-1111111111111111111111111111111111111111--11111--- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-1111111111111111111111111111111111111111111111111111111111111111-11-111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 2111--1-422-2221-11-222122122111122211-11112221-1111111111----21222112232222222222222233-242-222212-1123351-112111-11---1-1111-1-221-213--1-1--1--1-----111111-14-11111113111-2214-----211673132--1111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIQQESRLKVADNSGAREILVIKILGGSRVKTANIGDIIVATVKQATPGGVVKKGDVVKA:Sequence :ccccccEEEEcccccEEEEEEEEEccccccccccTTcEEEEEEEEEccccccccccEEEE:Sec Str : XXXXXXXXXXXX:SEG|49->63|ggvvkkgdvvkavvv : #:PROS|60->86|PS00049|RIBOSOMAL_L14|PDOC00048| :============================================================:RP:SCP|1->122|1s72K|1e-37|37.3|118/132|b.39.1.1 :============================================================:BL:SWS|1->122|RL14_LACS1|4e-55|100.0|122/122 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->122|PF00238|2e-30|59.8|122/122|Ribosomal_L14 61: . . . * . .: 120 :VVVRTKYGTHRPDGSYIKFDENAAVIIGEDKSPKGTRIFGPVARELRDGNFMKIVSLAPE:Sequence :EEEEccccEEcTTccEEcccccEEEEccTTcccccccccccccGGGTTTTcHHHHHHccc:Sec Str :XXX :SEG|49->63|ggvvkkgdvvkavvv :########################## :PROS|60->86|PS00049|RIBOSOMAL_L14|PDOC00048| :============================================================:RP:SCP|1->122|1s72K|1e-37|37.3|118/132|b.39.1.1 :============================================================:BL:SWS|1->122|RL14_LACS1|4e-55|100.0|122/122 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->122|PF00238|2e-30|59.8|122/122|Ribosomal_L14 121: . . + . . .: 180 :VL :Sequence :cc :Sec Str :== :RP:SCP|1->122|1s72K|1e-37|37.3|118/132|b.39.1.1 :== :BL:SWS|1->122|RL14_LACS1|4e-55|100.0|122/122 :$$ :RP:PFM|1->122|PF00238|2e-30|59.8|122/122|Ribosomal_L14