[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE00229.1 lsal0 rplN "LSU ribosomal protein L14P"
MIQQESRLKVADNSGAREILVIKILGGSRVKTANIGDIIVATVKQATPGGVVKKGDVVKA
VVVRTKYGTHRPDGSYIKFDENAAVIIGEDKSPKGTRIFGPVARELRDGNFMKIVSLAPE
VL
//