[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:rplU"

rplU        "LSU ribosomal protein L21P"
RL21_LACS1  "RecName: Full=50S ribosomal protein L21;"

OrgPattern -------------------------------------------------------------------- -----1---------------1----------1--------------1----------------111----111111111-1-1----11--1---1--111111--1-1-------111----1--------------111111-1111--1--11---1--1--11111--1-------1-11111-1-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111-1111-111-111-111-----------11111111111-11-11-1--1-11111111111111-1-111-1111111111111111---1111-------1--111111111111111----1-----111111111111111111111-11111111111111111111111111111111111111111-11111111111111111111111111111111111-111------------1-------11-11111111111111111111111111111111111-1111111-111--11-11111-111-11-1111111111111111111111111111-11-1111111111-111111111-111111111111-111111111111111111111-11----111-111111111-111111-11-1----1------------111111111111111111111111-1111111------------1-111111111-111111-111-11111111-111111111--1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------------11------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MYAIIKTGGKQLKVEAGQTIYVEKLDAKEGDKVTFDKVVFVGGDKTVIGTPFVEGATVEA:Sequence :cccccccccccccccTTccccccccTccTTcEEEcTTcccccccccccccccccccccEE:Sec Str :============================================================:RP:SCP|1->102|1vs6R1|2e-26|40.2|102/103|b.155.1.1 :============================================================:BL:SWS|1->102|RL21_LACS1|5e-47|100.0|102/102 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->95|PF00829|4e-19|60.0|95/96|Ribosomal_L21p 61: . . . * . .: 120 :TVEKQGRAKKVVTFKYKPKKHQHTKQGHRQPYTKVVIDAINA :Sequence :EcccccccccccEEEccTTTTccEEEcccccccccccccccc :Sec Str : XXXXXXXXXXXX :SEG|69->80|kkvvtfkykpkk : ####################### :PROS|71->93|PS01169|RIBOSOMAL_L21|PDOC00899| :========================================== :RP:SCP|1->102|1vs6R1|2e-26|40.2|102/103|b.155.1.1 :========================================== :BL:SWS|1->102|RL21_LACS1|5e-47|100.0|102/102 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->95|PF00829|4e-19|60.0|95/96|Ribosomal_L21p