[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99766.1 lsal0 rplU "LSU ribosomal protein L21P"
MYAIIKTGGKQLKVEAGQTIYVEKLDAKEGDKVTFDKVVFVGGDKTVIGTPFVEGATVEA
TVEKQGRAKKVVTFKYKPKKHQHTKQGHRQPYTKVVIDAINA
//