[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:rpmE"

rpmE        "LSU ribosomal protein L31P"
RL31B_LACS1  "RecName: Full=50S ribosomal protein L31 type B;"

OrgPattern -------------------------------------------------------------------- --1111111111111-1----1--12-----121111111------11-1111111111111-211122211222211----1-----1111111111111111111111111111111111111--11--1111-------11----------------------------------------------111211111111111111-1122221-1111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-111-11--11111-111-1111-1111-----------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111111111111-11111-22222221-----1--1-11------1-11111111-------11---------------------------111----1-1----------------------1-111------11-1-111231111111-211111211121111-11-11111111111111111111111111--------1111111-1111---1------------1-111-1-1----1--11111111111--111111-1-----11-1-1111-11111--1111111112211111111111111----------11111111--1------------------------------------11 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------1---------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKQGIHPDYHEVVFMDSATGYKFLSGSTKNSEETIEWEDGNTYPLIRVEISSDSHPFYTG:Sequence :ccTTTcccccHHHHHcccccTTTccccccccccccccGGGTccccccccccccccccccc:Sec Str : ############:PROS|49->70|PS01143|RIBOSOMAL_L31|PDOC00880| :============================================================:RP:SCP|1->79|1vs6Z1|6e-22|40.0|65/70|d.325.1.2 :============================================================:BL:SWS|1->82|RL31B_LACS1|8e-47|100.0|82/82 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->79|PF01197|5e-18|65.7|67/69|Ribosomal_L31 61: . . . * . .: 120 :RQKFTQADGRVDRFNKKYGFTN :Sequence :ccccccccccccccccccc :Sec Str :########## :PROS|49->70|PS01143|RIBOSOMAL_L31|PDOC00880| :=================== :RP:SCP|1->79|1vs6Z1|6e-22|40.0|65/70|d.325.1.2 :====================== :BL:SWS|1->82|RL31B_LACS1|8e-47|100.0|82/82 :$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->79|PF01197|5e-18|65.7|67/69|Ribosomal_L31