[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99160.1 lsal0 rpmE "LSU ribosomal protein L31P"
MKQGIHPDYHEVVFMDSATGYKFLSGSTKNSEETIEWEDGNTYPLIRVEISSDSHPFYTG
RQKFTQADGRVDRFNKKYGFTN
//