[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:rpmG.2"

rpmG        "LSU ribosomal protein L33P"
RL332_LACS1  "RecName: Full=50S ribosomal protein L33 2;"

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------1-111111111-1-----------------------------------------------------------------------------------------------------------111111---1---------11111--1111-11111-1-1---22222222222222122221-111-1111111-111111-1-1111--1-11---11----1-111---1111111111---11111111--11--------111-11-1111-111-11-111-----1-1-111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------1------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-11---------------------11-1-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MANKKKVALACSECGSRNYTITENPNRTERLEVQKFCKYCGKHTLHRETK :Sequence : ccccccEEccccTTccccccccccTcccccccccccccccccccccccc :Sec Str : ================================================= :RP:SCP|2->50|1vs611|3e-10|30.6|49/54|g.41.8.6 :================================================== :BL:SWS|1->50|RL332_LACS1|3e-27|100.0|50/50 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->50|PF00471|7e-07|62.2|45/48|Ribosomal_L33