[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE00050.1 lsal0 rpmG.2 "LSU ribosomal protein L33P"
MANKKKVALACSECGSRNYTITENPNRTERLEVQKFCKYCGKHTLHRETK
//