[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:thrS"

thrS        "Threonyl-tRNA synthetase"
SYT_LACS1   "RecName: Full=Threonyl-tRNA synthetase;         EC=6.1.1.3;AltName: Full=Threonine--tRNA ligase;         Short=ThrRS;"

OrgPattern 11111121222222211211111111111111111111111111111112111111111111111111 1111211111111111111-11111111111112222211122212111111111112222211112121111111111112111122221211111--1111111111111111111111111211111111111111111111133111121111111111111122111111111111111111111111122222222222222221332222211121111111111211111111111111121121111111111111111111111111111111111111111111111111111111111111111111111121124111111111222112111212111112111111121121212111111111111111111211111111111111111111-11111111112111111111111111211112222221211111111111121121111111111111111111111111111111111111111111112111111121111111221111111112111111111111121111111111111111111211111111111111111111111111121211111111111111111111111111111111111211112222111111111111111-1111111111121111111111111111-11111111111111111111121111211111111111111111111111111111111111111111111111111111212111111111111111111111111111111112111111111111111111111111211111211111111111111111112112211111111111131211111-11111111111111111112111123222121 1111222-311122211222222222222222222122222222222222222212222222222222222122222-2322222222-1311111111111222212B324734643323333573639T3-66B3333933442344333494534213A11221423512322222F2222242442432252223 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSSIKITFPDNSVKEFDAGVTTAEIAKSISISLAKKAVAGKVDGNFVDLNQPLKEDGSIE:Sequence :cccccccccccTTcccccEETTEEEHHHHHHcEEEEccTTcccEEEEccGGccEEEEEEE:Sec Str : =========================================================:RP:SCP|4->62|1nyqA2|5e-20|61.0|59/59|d.15.10.1 :============================================================:BL:SWS|1->649|SYT_LACS1|0.0|100.0|649/649 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->63|PF02824|2e-12|51.7|60/60|TGS 61: . . . * . .: 120 :IITKDSNDGLVVLWRTAAQVLANALHELYPNMKFGMGDVTEHGFYFDTDNSESQVAETDF:Sequence :EEEccccGGGHHHHHcccccEEEEEEEEccccccTTHHHHHHHHHHHHHTGGGTTccTTc:Sec Str :== :RP:SCP|4->62|1nyqA2|5e-20|61.0|59/59|d.15.10.1 : ==========================================================:RP:SCP|63->244|1nyqA3|1e-38|47.5|179/179|d.67.1.1 :============================================================:BL:SWS|1->649|SYT_LACS1|0.0|100.0|649/649 :$$$ :RP:PFM|4->63|PF02824|2e-12|51.7|60/60|TGS 121: . . + . . .: 180 :EKISQKMSEIIKANLPIERVEFSEEEALNLVSGDEYQEELVRDVANKNNGRVVAYKQGDF:Sequence :ccEEEEEccEEEEEEEEcccccHHHHHHHHHHHHHHHHTTTccEEEEEEEEEEEEEcccc:Sec Str :============================================================:RP:SCP|63->244|1nyqA3|1e-38|47.5|179/179|d.67.1.1 :============================================================:BL:SWS|1->649|SYT_LACS1|0.0|100.0|649/649 181: . * . . . .: 240 :IDITDGVVLSSTGEVKIFKLLSVAGAYWKGASSNPMLQRIYGTAFYKQKDLDAELQRQKE:Sequence :ccccccTTEEEEEEETTEEEEEEEEcccHHHHHTTHHHHHHHHHHHHHHHHcccEEEEEE:Sec Str :============================================================:RP:SCP|63->244|1nyqA3|1e-38|47.5|179/179|d.67.1.1 :============================================================:BL:SWS|1->649|SYT_LACS1|0.0|100.0|649/649 241: + . . . . *: 300 :ARERDHRVIGNELDLFFVDPKVGAGLPYWMPNGATIRRVIERYIIDKEVAWGFQHVYTPV:Sequence :cccccccccccHHHHHHHHTcccTTcEEEcHHHHHHHHHHHHHHHHHTHHHTcEEccccc:Sec Str :==== :RP:SCP|63->244|1nyqA3|1e-38|47.5|179/179|d.67.1.1 : =========================================================:RP:SCP|244->540|1evkA2|e-100|37.6|290/291|d.104.1.1 :============================================================:BL:SWS|1->649|SYT_LACS1|0.0|100.0|649/649 : $$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|276->428|PF00587|2e-20|33.8|151/170|tRNA-synt_2b 301: . . . . + .: 360 :LANLNLYKQSGHWDHYREDMFPPMDMGDGEMLELRPMNCPSHIQVYNHHKRSYRELPLRI:Sequence :EEEHHHHHHHcGGGTcGGGccEEccccccccEEEcccccGGGGGTTTTcEEcGGGccEEE:Sec Str :============================================================:RP:SCP|244->540|1evkA2|e-100|37.6|290/291|d.104.1.1 :============================================================:BL:SWS|1->649|SYT_LACS1|0.0|100.0|649/649 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|276->428|PF00587|2e-20|33.8|151/170|tRNA-synt_2b 361: . . . * . .: 420 :AELGMMHRYEKSGALTGLSRVREMTLNDGHDFIEPDHIEDEIKTLIKLMTEVYNDFDITD:Sequence :EEcccEEEcccccccccTTcccEEEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHTcccc:Sec Str :============================================================:RP:SCP|244->540|1evkA2|e-100|37.6|290/291|d.104.1.1 :============================================================:BL:SWS|1->649|SYT_LACS1|0.0|100.0|649/649 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|276->428|PF00587|2e-20|33.8|151/170|tRNA-synt_2b 421: . . + . . .: 480 :YRFRLSYRDPKNTEKYFDDDEMWEKSQSKLKAAMDDMGLEYFEAEGEAAFYGPKIDVQTK:Sequence :EEEEEEccccEEEEEEEccGGGccGGGcTTcEEEEEccEEEEEEEEcTTHHHHHTTcEET:Sec Str : XXXXXXXXXXXXX :SEG|460->472|eyfeaegeaafyg :============================================================:RP:SCP|244->540|1evkA2|e-100|37.6|290/291|d.104.1.1 :============================================================:BL:SWS|1->649|SYT_LACS1|0.0|100.0|649/649 :$$$$$$$$ :RP:PFM|276->428|PF00587|2e-20|33.8|151/170|tRNA-synt_2b 481: . * . . . .: 540 :TALGGEETLSTIQLDFLLPERFDLKYIGADGEEHRPVMVHRGIVSTMERFTAYLTEMYKG:Sequence :TcccEEEEEEEEEETHHHHHHHTcEETccTccGTcccEEEEEEEEEHHHHHHHHHHHHcc:Sec Str :============================================================:RP:SCP|244->540|1evkA2|e-100|37.6|290/291|d.104.1.1 : ======================:RP:SCP|519->645|1o6dA|1e-26|14.2|127/147|c.116.1.3 :============================================================:BL:SWS|1->649|SYT_LACS1|0.0|100.0|649/649 541: + . . . . *: 600 :AFPTWLAPHQVDIIPVKNDLHMDYVNDLSSKLRAHGIRVTVDDRNEKMGYKIRQAQVNKI:Sequence :cGGGccHHHHHHHcccccccHHcccHHHHHHHHTTTcccEEEcccccHHHHHHHHHHTTc:Sec Str :============================================================:RP:SCP|519->645|1o6dA|1e-26|14.2|127/147|c.116.1.3 :============================================================:BL:SWS|1->649|SYT_LACS1|0.0|100.0|649/649 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|551->626|PF03129|1e-15|45.3|75/91|HGTP_anticodon 601: . . . . + .: 660 :PYTLVIGDEEVSNGTVTVRKYGEEKTNTMTKAEFKNLLFEDIENYSREK :Sequence :cEEEEEcHHHHTccEEEEEETTTccEEEEEHHHHHHHHHHHccHHHHHH :Sec Str :============================================= :RP:SCP|519->645|1o6dA|1e-26|14.2|127/147|c.116.1.3 :================================================= :BL:SWS|1->649|SYT_LACS1|0.0|100.0|649/649 :$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|551->626|PF03129|1e-15|45.3|75/91|HGTP_anticodon