[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:trmU"

trmU        "tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
MNMA_LACS1  "RecName: Full=tRNA-specific 2-thiouridylase mnmA;         EC=2.8.1.-;"

OrgPattern -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111-------111111111133331111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111121111111111111111111111111111111---1111111111111111111111111111111111111111111111111111222222212111111111121111111111111111112221122121111111111111111111111111111111111-111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111212111111111111212111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111-111111-11111111111111111111111111111111 ----111-311---1-----------------------------------------------11111111111111111111111111-111-11111111-1111-22122111121111-1112-318B1-3121111311111111-11-2121121--1311-114A11-32112I222223121-11222121- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKDKSQIRVVVGMSGGVDSSVSAYLLKQQGYDVVGVFMKNWDDKNDSGVCTVTEDYQDVA:Sequence : HHHHHHHccEEEEEccccccccccHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXX :SEG|9->22|vvvgmsggvdssvs : ======================================:RP:SCP|23->271|1jgtA1|9e-32|9.1|230/290|c.26.2.1 :============================================================:BL:SWS|1->375|MNMA_LACS1|0.0|100.0|375/375 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->362|PF03054|e-124|64.4|331/348|tRNA_Me_trans 61: . . . * . .: 120 :KVASQIGIPYYSVNFEKEYWDRVFTYFLDEYKNGRTPNPDIMCNKEVKFKAFLDYAMSID:Sequence :HHHHHHTcccccccTHHHHHHHTHHHHHHHHHTTccccTHHHHHHHTTTTHHHHHHHTcc:Sec Str :============================================================:RP:SCP|23->271|1jgtA1|9e-32|9.1|230/290|c.26.2.1 :============================================================:BL:SWS|1->375|MNMA_LACS1|0.0|100.0|375/375 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->362|PF03054|e-124|64.4|331/348|tRNA_Me_trans 121: . . + . . .: 180 :ADYIAMGHYAQLRRDEDGRVHLLRGADDNKDQTYFLSQLSQEQLQKVMFPIGHLQKSEVR:Sequence :ccEEEcccccEHEEEETTEEEEEccccGGGccGGGGGcccTHHHHHEEccGGGccHHHHH:Sec Str :============================================================:RP:SCP|23->271|1jgtA1|9e-32|9.1|230/290|c.26.2.1 :============================================================:BL:SWS|1->375|MNMA_LACS1|0.0|100.0|375/375 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->362|PF03054|e-124|64.4|331/348|tRNA_Me_trans 181: . * . . . .: 240 :RIAEEAGLATAKKKDSTGICFIGERNFSKFLGEFLPAQPGEMVTLDGEVKGNHFGLMNYT:Sequence :HHHHHHTcTTcccccccccTTcccccHHHHHTTTccccccccccTTccccccccccTTcc:Sec Str :============================================================:RP:SCP|23->271|1jgtA1|9e-32|9.1|230/290|c.26.2.1 :============================================================:BL:SWS|1->375|MNMA_LACS1|0.0|100.0|375/375 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->362|PF03054|e-124|64.4|331/348|tRNA_Me_trans 241: + . . . . *: 300 :IGQRKGLGIGGDGKSNEPWFVIGKDLKTNTLLVGQGYHNEHLYANSLDASKLSFVDDISD:Sequence :TTccccccccccccccccEEEEEccTTTTccEEEEcTTcGGGEEEEEEEEccccTTcccc:Sec Str :=============================== :RP:SCP|23->271|1jgtA1|9e-32|9.1|230/290|c.26.2.1 :============================================================:BL:SWS|1->375|MNMA_LACS1|0.0|100.0|375/375 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->362|PF03054|e-124|64.4|331/348|tRNA_Me_trans 301: . . . . + .: 360 :CGDEFHCTAKFRYRQKDTGVTVKFNEDRTKVEVIFDEPVRAITPGQEVVFYDGEECLGSG:Sequence :cccEEEEEEEccTTcccEEEEEEcccccccEEEEEEEEEETccTTcEEEEEETTEEEEEE:Sec Str :============================================================:BL:SWS|1->375|MNMA_LACS1|0.0|100.0|375/375 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->362|PF03054|e-124|64.4|331/348|tRNA_Me_trans 361: . . . * . .: 420 :TIDHAYKESKLLQYV :Sequence :EEEEEEEcccccTTc :Sec Str :=============== :BL:SWS|1->375|MNMA_LACS1|0.0|100.0|375/375 :$$ :RP:PFM|23->362|PF03054|e-124|64.4|331/348|tRNA_Me_trans