[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:uppS"

uppS        "Undecaprenyl pyrophosphate synthetase"
            ""

OrgPattern 11111111111111111111111112222221111111111112222221332111111111111-11 1221222222222222222-22223222222323332222222222222222222222222222222233211111111111111111111111111--11111111111111111111111111111111111111111111111221111111111111111111222111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122212222232222122212221211111111112211212111111112111111-----112221111122111111111111-222222211111111111111111111111111111111111111112111111111------111111111111111111111111111111111112111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111121111-1111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------------1------1111111111111 ---1111-21111111111111111211111112121111111111111111111111111121222212222222222222222211-12-1213111112111111412111111111-11155141CG2-411-1112-121111111111111122111111-121111112222F2222133271992232222 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLDFFNKKENMDEKRNKLKRELIPNHIAIIMDGNGRWAKKRHLPRIAGHKQGMETVKNIT:Sequence :EEEcTTcHHHHHHHHHHHcTTccccEEEEEEccHHHHHHHHTccHHHHHHHHHHHHHHHH:Sec Str : ======================================:RP:SCP|23->249|1jp3A|8e-78|42.6|209/214|c.101.1.1 :============================================================:BL:SWS|1->259|UPPS_LACPL|1e-98|66.0|259/259 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|30->253|PF01255|5e-65|52.5|221/222|Prenyltransf 61: . . . * . .: 120 :KVASNLGVKVLTLYAFSTENWKRPDKEVDFLMDLPVKFFNTFVPELIENNVRVNVMGYID:Sequence :HHHHHTTccEEEEEEccccGGGccHHHHHHHHHHHHHHTTTHHHHHHHTTcEEEEEcccT:Sec Str :============================================================:RP:SCP|23->249|1jp3A|8e-78|42.6|209/214|c.101.1.1 :============================================================:BL:SWS|1->259|UPPS_LACPL|1e-98|66.0|259/259 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|30->253|PF01255|5e-65|52.5|221/222|Prenyltransf 121: . . + . . .: 180 :MLPKKTQKAVYDAIEQTSNCTGMVLNFALNYGGRAELVSAIQSIASKVSENKLEIEKITE:Sequence :TccHHHHHHHHHHHHHHTTccccEEEEEccccHHHHHHHHHHHHHHHHHHTcccGGGccH:Sec Str :============================================================:RP:SCP|23->249|1jp3A|8e-78|42.6|209/214|c.101.1.1 :============================================================:BL:SWS|1->259|UPPS_LACPL|1e-98|66.0|259/259 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|30->253|PF01255|5e-65|52.5|221/222|Prenyltransf 181: . * . . . .: 240 :KVVDANLMTGKLAPYNDPDLLIRTSGEERISNFLLWQLAYSEFVFTDTLWPDYSEEDLLA:Sequence :HHHHTTcTTTTccccccccEEEEcccccccTTcccGGGTTcEEEEccccGGGccHHHHHH:Sec Str : ################## :PROS|199->216|PS01066|UPP_SYNTHETASE|PDOC00817| :============================================================:RP:SCP|23->249|1jp3A|8e-78|42.6|209/214|c.101.1.1 :============================================================:BL:SWS|1->259|UPPS_LACPL|1e-98|66.0|259/259 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|30->253|PF01255|5e-65|52.5|221/222|Prenyltransf 241: + . . . . *: 300 :NIYTFQTRDRRFGRLKEEKK :Sequence :HHHHHHHHcHHcTc :Sec Str :========= :RP:SCP|23->249|1jp3A|8e-78|42.6|209/214|c.101.1.1 :=================== :BL:SWS|1->259|UPPS_LACPL|1e-98|66.0|259/259 :$$$$$$$$$$$$$ :RP:PFM|30->253|PF01255|5e-65|52.5|221/222|Prenyltransf