[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "nfar0:BAD60776.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHQWCTPPGCRVVAALAVGRLRMAGESRNQRAGVRRTRQANVAGGRSHRCVVKLSDSEYA:Sequence 61: . . . * . .: 120 :DLTVRAEAAGMTVPRLLVETTLGKATPEVGRAAAALRALEEGEQDRRALNNLNQLVRYSH:Sequence : XXXXXXXXXXXXXX :SEG|90->103|graaaalraleege 121: . . + . . .: 180 :QNRELAEGLPLAVAAVVRAALQMDALARWVMGETPSVSPSVIGEDQLAAAQEWVERVDNL:Sequence : XXXXXXXXX :SEG|132->140|avaavvraa : X:SEG|180->196|lgvlgidediddvdggg 181: . * . . . .: 240 :GVLGIDEDIDDVDGGGV :Sequence :XXXXXXXXXXXXXXXX :SEG|180->196|lgvlgidediddvdggg