[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAD60776.1 nfar0 BAD60776.1 "hypothetical protein"
MHQWCTPPGCRVVAALAVGRLRMAGESRNQRAGVRRTRQANVAGGRSHRCVVKLSDSEYA
DLTVRAEAAGMTVPRLLVETTLGKATPEVGRAAAALRALEEGEQDRRALNNLNQLVRYSH
QNRELAEGLPLAVAAVVRAALQMDALARWVMGETPSVSPSVIGEDQLAAAQEWVERVDNL
GVLGIDEDIDDVDGGGV
//