[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA56702.1"

            "adenine phosphoribosyltransferase"
APT_NITOC   "RecName: Full=Adenine phosphoribosyltransferase;         Short=APRT;         EC=2.4.2.7;"

OrgPattern --------------------------------------11111-----------------------11 111-111111111111111-11--111111111111111111111111112---1111--21111111111111111111-11-----1112-------111-11-1--1---------------1111111111111111---1-1111111111111111111111111111111111112--1----1111111121111311111221111111111112222222212111111111111111111112111111111122--11111111111111111121121111111111111111111111112211111211111111111111111111111111111111--11111-111-11211111-1---------111111111111-11111111111-11111111111-1111221111111-1-111111112111111111111111111-----------------------------111-1-111111111111-1111111111111111111111111-11111--1------111111111111111---1-11-----11----111111111111111--1111111111111111111111111--11111-111111111111111111111111--11---------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111111----------1--11111111111111111-------111--222222222222222221111111111111111111111111111111111-------111111111111111111----1-111111111111111111211111111111-- ----111-212111112111112112111111111-111111111111221131-1221111111111112-1112222211111111-12121111111111111-1414112221111-11-12-21232-112---11-111-11-11--11-1121-11211111111111-1118111111475171113212- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MARLARTFCDGHHKSQGVRFICLFNPNHIKCLPQILVYLGKASMERLKTKIRDIPDFPKP:Sequence : EEccHHHHHHTTcEEEEEccTTEEEEEETTccEEEEEccHHHHHHHHcEEEETcccT:Sec Str : ==============:RP:SCP|47->203|1mzvA|3e-45|36.3|157/216|c.61.1.1 : =================:BL:SWS|44->214|APT_NITOC|1e-96|100.0|171/171 61: . . . * . .: 120 :GVLFKDITPLVGDPATLRLAVHQLLHPFLEQDITAVGGIEARGFIFGALVAWELGVGFIP:Sequence :TcEEEETHHHHTcHHHHHHHHHHHHHHHTTTTccEEEEEccTTHHHHHHHHHHHTcEEEE:Sec Str :============================================================:RP:SCP|47->203|1mzvA|3e-45|36.3|157/216|c.61.1.1 :============================================================:BL:SWS|44->214|APT_NITOC|1e-96|100.0|171/171 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|92->189|PF00156|8e-07|35.8|95/116|Pribosyltran 121: . . + . . .: 180 :LRKSGKLPYEVRSISYQLEYGSASLEAHTDSLGPGDNVLLVDDLLATGGTAKASCELVES:Sequence :EccTTcccccEEEEEEEETTEEEEEEEEGGGccTTcEEEEEEEEEcccHHHHHHHHHHHH:Sec Str : ############# :PROS|158->170|PS00103|PUR_PYR_PR_TRANSFER|PDOC00096| :============================================================:RP:SCP|47->203|1mzvA|3e-45|36.3|157/216|c.61.1.1 :============================================================:BL:SWS|44->214|APT_NITOC|1e-96|100.0|171/171 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|92->189|PF00156|8e-07|35.8|95/116|Pribosyltran 181: . * . . . .: 240 :LGATVAACAFVIELDFLHGRERLSDYTVHSLVHY :Sequence :TTcEEEEEEEEEEEGGGcHHHHHHTTEEEEEEEE :Sec Str :======================= :RP:SCP|47->203|1mzvA|3e-45|36.3|157/216|c.61.1.1 :================================== :BL:SWS|44->214|APT_NITOC|1e-96|100.0|171/171 :$$$$$$$$$ :RP:PFM|92->189|PF00156|8e-07|35.8|95/116|Pribosyltran