[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA56724.1"

            "Thiosulfate sulfurtransferase"
            ""

OrgPattern 11----2122222222-2211---22223322--1-----------1-2-----------------33 --21123333313122244-432232444442322223432221212-122132222111322-3212212-----------32-122-----------1-1---1--2-------------------1-1-----22233---133113222-122------1-1-3232------------42211---1--1111111111111111111--1111111211------11--------------------------------------------------------------------------------------------1--3333322-2--1------------------1-3------------3--1111-----113351121112111111111111-11111111611-111111111122231111112322111222222223--1-111-----------------------------11111121112111111-111111121111-11121211111111122231211-1211---11----------1111-3111---------1-11-12---1---111-----------------------2----111-1--111--111-1-111111--1-----221-------21212212222222222-22222222222222222222221111111111111111111111221---2--111111111111-------------11211---------------1111111---2322222222322222222---------2122111111321111111111111------1-111111----------------------------------------------21- ----11------2211111111122211111-11111211-11111-1111111111-1111-1-1111-11---1111-------11-1-111111-1111-111-1112322212112122243172FI4-323-222211422211-2-1214123----93------122-----1111111232131-13322- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAMFSLLLQPDELVRRLDEKNLLLIDLGSEESYLARHVPGAVHLDYTHIVAARPPVMGLL:Sequence :GTTcccEEcHHHHHTTTTcTTEEEEEcccHHHHHHcccTTcEEccGGGGccccTTcTTcc:Sec Str : ############ :PROS|33->44|PS00380|RHODANESE_1|PDOC00322| : =========================================================:RP:SCP|4->124|1e0cA1|1e-30|38.0|121/135|c.46.1.2 : ===========================================================:BL:SWS|2->270|THTR_AZOVI|2e-61|44.2|265/271 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->117|PF00581|1e-09|33.7|95/108|Rhodanese 61: . . . * . .: 120 :PDEHRLSRVLSQLGFTPESHVVAYDAEGNGRASRLLWTLEELGHKHFSLLDGGLKAWLVE:Sequence :ccHHHHHHHHHHHTccTTcEEEEEcccccHHHHHHHHHHHHTTcccEEEETTHHHHHHHT:Sec Str :============================================================:RP:SCP|4->124|1e0cA1|1e-30|38.0|121/135|c.46.1.2 :============================================================:BL:SWS|2->270|THTR_AZOVI|2e-61|44.2|265/271 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|17->117|PF00581|1e-09|33.7|95/108|Rhodanese 121: . . + . . .: 180 :ECPVKEGRESRQPSHFHGRYQGHQAADKEYILAHLLDPKVVILDARSPAEYHGEYVRAQR:Sequence :TcccccccccccccccccccccTTcccHHHHHHHTTcTTEEEEEcccHHHHTTccccccc:Sec Str :==== :RP:SCP|4->124|1e0cA1|1e-30|38.0|121/135|c.46.1.2 : ================================:RP:SCP|149->268|1okgA2|3e-30|22.7|119/134|c.46.1.2 :============================================================:BL:SWS|2->270|THTR_AZOVI|2e-61|44.2|265/271 : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|157->260|PF00581|2e-11|44.1|93/108|Rhodanese 181: . * . . . .: 240 :GGHIPGAVNFEWTQAIDQERNLRFKPMDELRSSLEALGITPDKEVICYCQTHHRSAHTCM:Sequence :ccccTTcEEccGGGGcGEEGGGTTEEcTTHHHHHHHTTTccTTcEEEEEccccHHHHHHH:Sec Str :============================================================:RP:SCP|149->268|1okgA2|3e-30|22.7|119/134|c.46.1.2 :============================================================:BL:SWS|2->270|THTR_AZOVI|2e-61|44.2|265/271 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|157->260|PF00581|2e-11|44.1|93/108|Rhodanese 241: + . . . . *: 300 :VLKYLGYPKIKGYPGSWSEWGNAPDTPIKV :Sequence :HHHHTTcccEEEcccHHHHHTTcTTccccc :Sec Str :============================ :RP:SCP|149->268|1okgA2|3e-30|22.7|119/134|c.46.1.2 :============================== :BL:SWS|2->270|THTR_AZOVI|2e-61|44.2|265/271 :$$$$$$$$$$$$$$$$$$$$ :RP:PFM|157->260|PF00581|2e-11|44.1|93/108|Rhodanese