[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA56789.1"

            "SSU ribosomal protein S6P modification protein"
            ""

OrgPattern 1112112222222222-444343-2--11122---11211112-111112212-121-1-----1-22 ----1--1---------------------------------------1--------1--------------------------------------------------1----------------------------11111---12-11-111----1-----1------1------------11111----------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------2----------1-----------------------11111111-----------------1111-------1--------------1---------------------------------1-----------------------2--------1---------11-------1-----111-----------------1--11--11-----------1-112111----------------------1---11111--11-1112322221213333231-3-----2111------1111-1-1111111111-111111111111111111111111---111111111111111111111111-----------------1111111111112--111-11111111111----------1111111111111111111---------211121111111111---1-11111--------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLRIVIFNNSHGWHSKQLEAALAPQGVAIIRSNLAQCRIDLDSPSGLHIPGLGGDLPDAA:Sequence :cEEEEEEccTTccHHHHHTTcEEcccEccccTTcccTTcEEEEEcccTTTcEEEEEcccE:Sec Str : =:BL:SWS|60->290|MPTN_METMP|2e-32|36.5|222/292 61: . . . * . .: 120 :IVRGIAAGSFEQITLRLDVLHTLAEFGIPVLNTASAIERTVDKARTSLLLRHRRVPTPRA:Sequence :EEccccHHHHHHHHHHHHHTTHHHHHTcEEcccHHHHHHHHcHHHHHHHHHHTTcccccE:Sec Str : ===================:RP:SCP|102->290|1eyzA3|6e-16|9.8|183/204|d.142.1.2 :============================================================:BL:SWS|60->290|MPTN_METMP|2e-32|36.5|222/292 : $$$$$$$$$$$$$$$$$$$:RP:PFM|102->273|PF08443|7e-17|36.6|164/177|RimK 121: . . + . . .: 180 :WACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLYYLQEF:Sequence :EEEccHHHHHcHHHHHHHHcccEEEEETTccTTTTcEEEccHHHHHHHHcTTccEEEEEc:Sec Str :============================================================:RP:SCP|102->290|1eyzA3|6e-16|9.8|183/204|d.142.1.2 :============================================================:BL:SWS|60->290|MPTN_METMP|2e-32|36.5|222/292 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|102->273|PF08443|7e-17|36.6|164/177|RimK 181: . * . . . .: 240 :IRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNVARGAQYFPAPLEREIGALACQATQ:Sequence :cTTcEEEEEEEEEcTTccEEEEEEEEEcccTTccGGGccEEEcccccHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|102->290|1eyzA3|6e-16|9.8|183/204|d.142.1.2 :============================================================:BL:SWS|60->290|MPTN_METMP|2e-32|36.5|222/292 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|102->273|PF08443|7e-17|36.6|164/177|RimK 241: + . . . . *: 300 :AVAVDYGGVDIIQTPAQGFQVLEVNSIPSWKALQQTTEVNIAGALAKNLLERLHSSYFAH:Sequence :HHTcccEEEEEEcTTTccEEEEEEEccccHcTTcHHTTccHHHHHHHHHHHHcHH :Sec Str :================================================== :RP:SCP|102->290|1eyzA3|6e-16|9.8|183/204|d.142.1.2 :================================================== :BL:SWS|60->290|MPTN_METMP|2e-32|36.5|222/292 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|102->273|PF08443|7e-17|36.6|164/177|RimK 301: . . . . + .: 360 :SGSSQKI :Sequence : :Sec Str