[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA56789.1 noce0 ABA56789.1 "SSU ribosomal protein S6P modification protein"
MLRIVIFNNSHGWHSKQLEAALAPQGVAIIRSNLAQCRIDLDSPSGLHIPGLGGDLPDAA
IVRGIAAGSFEQITLRLDVLHTLAEFGIPVLNTASAIERTVDKARTSLLLRHRRVPTPRA
WACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLYYLQEF
IRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNVARGAQYFPAPLEREIGALACQATQ
AVAVDYGGVDIIQTPAQGFQVLEVNSIPSWKALQQTTEVNIAGALAKNLLERLHSSYFAH
SGSSQKI
//