[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA56844.1"

            "diaminopimelate epimerase"
DAPF_NITOC  "RecName: Full=Diaminopimelate epimerase;         Short=DAP epimerase;         EC=5.1.1.7;"

OrgPattern -----------------------1----1-1-11111111111111111----1-------------- 11111111111-1-11111-1-111111111111111-111111111-111111111---11111112111-11111-----111111111111--111111-1111111-1111111111111111111111111-----111--1111111111111111111112211111111111111-----111111111111111111111111111111111-1--11111121---------------------1--1--1-1-111111-----------------------------------------------------111111111111111-11111112-1--1111111111-11111111--111-111111111111111111111111111111111-111111111111111112111111111111111111111111111111111111111-11111----11111111111111111111111111111222211111111111-1111211111111111111111111111111111111111111111111111111111111111111111111111111211----1-111----------11111111111111111111111111111111111111-1111111111111111111111111111-1111111111111111111121111111111111111111111111111111111111111111111111111111111121211111111111111111111111111111111212121211111---------111111111111111111111111111111111111111------------------------------------------1---111 ----421--------------------------------------------1--------------------------------------------------------1-------------------------------------------------2----21---------21111811111---2-1211----1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRIAFTKMQGLGNDFVVIDALSQPLSLTASQVRWIANRRLGIGCDQVLLVTPASLPAIDF:Sequence :EEcEEEEEEETTEEEEEEETTcccccccHHHHHHHHcTTTcccccEEEEEEccccTTccE:Sec Str : ==========================================================:RP:SCP|3->132|1bwzA1|9e-37|53.1|130/130|d.21.1.1 :============================================================:BL:SWS|1->276|DAPF_NITOC|e-151|100.0|276/276 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->121|PF01678|6e-23|43.9|114/120|DAP_epimerase 61: . . . * . .: 120 :GYRIFNADGGEVEQCGNGARCFARFVREQGLTDKNVLRVQTASGIIELQLETDGQITVDM:Sequence :EEEEEETTccccccTTTTHHHHHHHHHHTTcccccEEEEEccccEEEEEEcTTccEEEEc:Sec Str : ############### :PROS|66->80|PS01326|DAP_EPIMERASE|PDOC01029| :============================================================:RP:SCP|3->132|1bwzA1|9e-37|53.1|130/130|d.21.1.1 :============================================================:BL:SWS|1->276|DAPF_NITOC|e-151|100.0|276/276 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->121|PF01678|6e-23|43.9|114/120|DAP_epimerase 121: . . + . . .: 180 :GVPRFAPHQIPFKVDQEADYYSLELDGQQVEIGAVSMGNPHCVLRVPAVDTAPVAHWGPL:Sequence :ccccccGGGTTcccccccccEEEEETTEEEEEEEEEcccEEEEEEcccTTTccHHHHHHH:Sec Str :============ :RP:SCP|3->132|1bwzA1|9e-37|53.1|130/130|d.21.1.1 : ==============================================:RP:SCP|135->276|1bwzA2|4e-48|45.8|142/144|d.21.1.1 :============================================================:BL:SWS|1->276|DAPF_NITOC|e-151|100.0|276/276 :$ :RP:PFM|6->121|PF01678|6e-23|43.9|114/120|DAP_epimerase 181: . * . . . .: 240 :LESHPRFPQRVNVGFAQIVSPGHLRLRVYERGAGETPACGTGACAAAVIGKRRGWLSGQV:Sequence :HHTcTTcTTccEEEEEEEEETTEEEEEEEETTTEEccccHHHHHHHHHHHHHTTcccccE:Sec Str : XXXXXXXXXXXXXXXX :SEG|212->227|gagetpacgtgacaaa :============================================================:RP:SCP|135->276|1bwzA2|4e-48|45.8|142/144|d.21.1.1 :============================================================:BL:SWS|1->276|DAPF_NITOC|e-151|100.0|276/276 241: + . . . . *: 300 :NVDLPGGRLGIHWEGDGKSVWMSGPAEIVFKGSIEL :Sequence :EEEccccEEEEEcccTTcccEEEEccEEEEEEEccc :Sec Str :==================================== :RP:SCP|135->276|1bwzA2|4e-48|45.8|142/144|d.21.1.1 :==================================== :BL:SWS|1->276|DAPF_NITOC|e-151|100.0|276/276