[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA56902.1"

            "response regulator receiver modulated diguanylate cyclase/phosphodiesterase"
            ""

OrgPattern -----------------------1--------------------1--1-------------------- C3-26---111----3322-2822-122222-34442332A678S-------335-----762-6284442----1----7-66DM89--------------------1----------------11-1111-11-67734---72aNIDDD222AA---3--9G6-77E3------------F14--1--49-888886793989889-21122998443A1ED1----289--------------------------1---------------------------------------------------------------4686G33333336383J465344624--46674768432217121331--82458851111125RJG658IFBHM5566566465A-KIHHE8DL8G31GHHGMQLRRRHDF89AA2818A56764--------A994-T8K111-----11112222122222111---1-8AA83A77229676887666566LO7777469GL8EDK--EDARBMCEH14d75IILGGTXOF-------67ENbY3BE79DBJ5IHGDG-GCDRDGBOI11216532C5541---------------PEHRF43PLDSXQcHVMgVXWWYRgNXXVSRQOMSSW--1DRBW------CFA73H7IIIHIHJJHG-FIGIHEEHHHGIGGHHHIHDFBB9---C98BACBCCDBCCBBC7CB577AA--B45555534555---N-1-1-EGEGE5fCR---------------455551413-BTPPQOPRRMPLOLPLMPQ-----2---NBHHELLLLKSSOWWFEFFGFFFFH3333--O199429911111111313-------------------------11133------1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------5---------8-----------1--7-----7---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLSSKNIVRLLIVDASFEDAEMVTNLLRKMGFAARASRVEKEEEFREAIEGQSWDIIVCA:Sequence :ccccEEEEcEEEEEccHHHHHHHHHHHHHTTcEEcEEEEEccccccccccccEEEEEccc:Sec Str : ====================================================:RP:SCP|9->141|1a04A2|4e-09|12.9|132/138|c.23.1.1 : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|37->145|PF10345|3e-04|24.8|105/580|Cohesin_load 61: . . . * . .: 120 :AMLPQFSVARAAQILLQSEKDISLIIVVDEKTDSDDIDEMYVAGVRDVVLKSRPLRLQSV:Sequence :cccHHHHHHHHHHHHHHHHHTTccEEEEEccTTccccTTccHHHHHHHHHHHTTcHHHHH:Sec Str :============================================================:RP:SCP|9->141|1a04A2|4e-09|12.9|132/138|c.23.1.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|37->145|PF10345|3e-04|24.8|105/580|Cohesin_load 121: . . + . . .: 180 :IKRELQDLENRRARRHSEMVLGESERQVRALLESSRDAVGYVHEGMHIYANRAYLELFGY:Sequence :HHGGGGccccEEEcccccccEEEcccccccEEEEccHHHHHHcccccccTTcHHHHHHHH:Sec Str :===================== :RP:SCP|9->141|1a04A2|4e-09|12.9|132/138|c.23.1.1 : ===============================================:RP:SCP|134->272|2axtC1|1e-13|5.8|137/447|f.55.1.1 : ================================================:BL:SWS|133->678|Y3085_AZOC5|3e-35|26.0|524/735 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|37->145|PF10345|3e-04|24.8|105/580|Cohesin_load 181: . * . . . .: 240 :HELDEIEGMPLLDMIAPEEHNRFKAFLKEYGASEGKSAHFTLRAHKADGHTFTAAWEFTP:Sequence :HHHHHHHHHHHcEEEEcccEEEETTEEEEcGGGcccccTTcTTTccHHHHHHHHHHHTTc:Sec Str :============================================================:RP:SCP|134->272|2axtC1|1e-13|5.8|137/447|f.55.1.1 :============================================================:BL:SWS|133->678|Y3085_AZOC5|3e-35|26.0|524/735 241: + . . . . *: 300 :ASIEGEFCTQIVIRDKTYDLAAEERIKQVQQRDILTGFFSRPHYLELMEKWVIAARAGDR:Sequence :cccccccccccEEEEEccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHTHHH:Sec Str :================================ :RP:SCP|134->272|2axtC1|1e-13|5.8|137/447|f.55.1.1 : ==========================:RP:SCP|275->433|1w25A3|8e-24|22.6|159/162|d.58.29.2 :============================================================:BL:SWS|133->678|Y3085_AZOC5|3e-35|26.0|524/735 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|273->426|PF00990|7e-18|31.8|154/160|GGDEF 301: . . . . + .: 360 :ESSLLYIAIDQFNRVRARVGIGASDLVVVDVARILQQYCDEKVILARFGDEVFTLLLPHG:Sequence :HHHHHHHHHTTEEEccGGGcccGGGGEEEcccccccccHHHHHHcTTTHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|275->433|1w25A3|8e-24|22.6|159/162|d.58.29.2 :============================================================:BL:SWS|133->678|Y3085_AZOC5|3e-35|26.0|524/735 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|273->426|PF00990|7e-18|31.8|154/160|GGDEF 361: . . . * . .: 420 :SDEQEDALAEQLRQAVDRHLVEMDERSINVTCSIGICRIGESAPGGQQILERAHKACLKA:Sequence :ccEEEEEcccHccccHHHHHHHHHHHHTccccccccGGGGGGcccHcHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|275->433|1w25A3|8e-24|22.6|159/162|d.58.29.2 :============================================================:BL:SWS|133->678|Y3085_AZOC5|3e-35|26.0|524/735 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|273->426|PF00990|7e-18|31.8|154/160|GGDEF 421: . . + . . .: 480 :QEAGGNRIERYRPVIEDLTDQEKIKQWEVQLREAMNNKDGFCLFYQPIVSLHGETEEIFE:Sequence :HHTccccEEccccHHHHHHcccGGGccHHHHHHHHHHHHGHHccccccccccTccEEEEE:Sec Str :============= :RP:SCP|275->433|1w25A3|8e-24|22.6|159/162|d.58.29.2 : ============================:RP:SCP|453->684|2basA1|7e-38|23.0|222/257|c.1.33.1 :============================================================:BL:SWS|133->678|Y3085_AZOC5|3e-35|26.0|524/735 :$$$$$$ :RP:PFM|273->426|PF00990|7e-18|31.8|154/160|GGDEF : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|450->684|PF00563|8e-33|35.5|234/236|EAL 481: . * . . . .: 540 :VLLRMTDDAGGYILPEKFLEPAAQLKLMGEIDRWVIAKAMSVLHSRHQVGQLIRFFVKLS:Sequence :EEEcHHHHHHHHHHHHHHHTTcccccccEEccccccTTccEETTTTEEGGGGcccccccc:Sec Str :============================================================:RP:SCP|453->684|2basA1|7e-38|23.0|222/257|c.1.33.1 :============================================================:BL:SWS|133->678|Y3085_AZOC5|3e-35|26.0|524/735 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|450->684|PF00563|8e-33|35.5|234/236|EAL 541: + . . . . *: 600 :DPSIHDKNLLPWLKKHLQESGLDARSLIFEISESSALNYLKRVQQLVEGLRVLGCQFALE:Sequence :cEEccccccccccccEEcGGGcccccccccTTTcccccccHHHHHHHHHHHHHccHHHHH:Sec Str :============================================================:RP:SCP|453->684|2basA1|7e-38|23.0|222/257|c.1.33.1 :============================================================:BL:SWS|133->678|Y3085_AZOC5|3e-35|26.0|524/735 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|450->684|PF00563|8e-33|35.5|234/236|EAL 601: . . . . + .: 660 :HVGTGLDTSNCLKHINVDYLKIDGAFIENLLQDEQNQEAVKIIIEMAKEAGKPTIAEFVS:Sequence :HHHTTHHHHHHHHHHHHHHHHTTcTccTTcccHHHHHHHHHHHHHccccccccEEccccT:Sec Str :============================================================:RP:SCP|453->684|2basA1|7e-38|23.0|222/257|c.1.33.1 :============================================================:BL:SWS|133->678|Y3085_AZOC5|3e-35|26.0|524/735 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|450->684|PF00563|8e-33|35.5|234/236|EAL 661: . . . * . .: 720 :DANTLALLWQFGLDYAQGRYIQEPNQFLSYEFSGGI :Sequence :THHHHHHTcEEEEEEccTTTTcccccccccccccc :Sec Str :======================== :RP:SCP|453->684|2basA1|7e-38|23.0|222/257|c.1.33.1 :================== :BL:SWS|133->678|Y3085_AZOC5|3e-35|26.0|524/735 :$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|450->684|PF00563|8e-33|35.5|234/236|EAL