[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA56915.1"

            "Polynucleotide adenylyltransferase"
CCA_NITOC   "RecName: Full=Multifunctional CCA protein;Includes:  RecName: Full=CCA-adding enzyme;           EC=2.7.7.25;           EC=2.7.7.21;  AltName: Full=tRNA nucleotidyltransferase;  AltName: Full=tRNA adenylyl-/cytidylyl-transferase;  AltName: Full=tRNA CCA-pyrophosphorylase;  AltName: Full=tRNA-NT;Includes:  RecName: Full=2'-nucleotidase;           EC=3.1.3.-;Includes:  RecName: Full=2',3'-cyclic phosphodiesterase;           EC=3.1.4.-;Includes:  RecName: Full=Phosphatase;           EC=3.1.3.-;"

OrgPattern ---------------------------------------------------1---------------- 122-111111111111111-111111111111111111111111-11111111211111111111111111111111111121211-1111111--11-11111111111111111122211111111111111111--22111112111---21111----11-121111------------1-1--12--11111111111111111121111111111111----1--11-1111111--11111-111111-111111-111111-1-11-1-1111111111--1111111111111111111111111111111111-21--111111111-1111----1121-1-1122221111121-11-111-1-----11111-1-----------1111111111-----------1--111111-11-11-1--1-------11-111111111---1-----------------------------------1--1111111111111111111111111111111111111111111111111111111111111111111112111112232222221-3332333111121-12111111111111--11111111111133121111111111111111111111-111111-2122111111121111211111111111-1111111111111111112222111111111111111111111111111111111111111111111111111121222112211112112222222111111111111111111111111111111111111111212211111111111212222222222221111--------------11--------------------------11-1111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------3--------------1--------------------2---- ------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEVYLVGGAVRDKLLGRPVKERDYVVVGTTPANLLAQGYRPVGKDFPVFLHPQTQEEYAL:Sequence :ccEEEETHHcTTHHHTcccHHHHHHHTTccHHHHcHHHHHHHHHEEHHHHHHHHcccGGG:Sec Str :============================================================:RP:SCP|1->118|1ou5A2|7e-26|27.3|110/140|d.218.1.4 :============================================================:BL:SWS|1->406|CCA_NITOC|0.0|100.0|406/406 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->122|PF01743|7e-17|51.7|116/123|PolyA_pol 61: . . . * . .: 120 :ARTERKTGPGYKGFEVDAAPDVTLEEDLQRRDLTINAIAEAADGSLLDPFGGQQDLARGI:Sequence :HHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccGGGcHHHHHTTTcccHHHHH:Sec Str :========================================================== :RP:SCP|1->118|1ou5A2|7e-26|27.3|110/140|d.218.1.4 : =:RP:SCP|120->325|1ou5A1|4e-26|14.4|194/204|a.173.1.1 :============================================================:BL:SWS|1->406|CCA_NITOC|0.0|100.0|406/406 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->122|PF01743|7e-17|51.7|116/123|PolyA_pol 121: . . + . . .: 180 :LRHVSPAFAEDPVRILRAARFAARFNFKVAPETLALMEAMVTAGEADHLVPERVWRELER:Sequence :HHHHHHHHHHHHHHHTTHHHHHHHHHHHcHHHHHHHHHHHHHHHHTTTTcGGGcHHHHHH:Sec Str : XXXXXXXXXXX :SEG|137->147|raarfaarfnf :============================================================:RP:SCP|120->325|1ou5A1|4e-26|14.4|194/204|a.173.1.1 :============================================================:BL:SWS|1->406|CCA_NITOC|0.0|100.0|406/406 :$$ :RP:PFM|3->122|PF01743|7e-17|51.7|116/123|PolyA_pol 181: . * . . . .: 240 :ALGESYPRRFFEILRACGALARIFPEIECLFGVPQPRRYHPEIDTGIHTLKVLEIAAHLS:Sequence :HHHHHTTccccTTccccHHHHHHHHHHHHHHGccccccHcccTHHHHHHHHHHHTcHHHH:Sec Str :============================================================:RP:SCP|120->325|1ou5A1|4e-26|14.4|194/204|a.173.1.1 :============================================================:BL:SWS|1->406|CCA_NITOC|0.0|100.0|406/406 241: + . . . . *: 300 :SDTQVRFAALTHDLGKGQTPSHEWPHHYGHGERGVALVLTLCQRLRVPKAYQALAVQVAR:Sequence :cHHHccHHHHHHHHHHTTccTTTTHHHHTTcccccGGGcTTHHHHHTcHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|120->325|1ou5A1|4e-26|14.4|194/204|a.173.1.1 :============================================================:BL:SWS|1->406|CCA_NITOC|0.0|100.0|406/406 301: . . . . + .: 360 :YHNLVHQAQELRPGTILKLLNRVDAFRRPSRFEQFLLACEADARGRSGLENRPYPQANQL:Sequence :HHHHHHHHcccHHHHHHHHHHHHHHHHHHHH :Sec Str : X:SEG|360->378|lrlafraaaavtarplvaa :========================= :RP:SCP|120->325|1ou5A1|4e-26|14.4|194/204|a.173.1.1 :============================================================:BL:SWS|1->406|CCA_NITOC|0.0|100.0|406/406 361: . . . * . .: 420 :RLAFRAAAAVTARPLVAAGLRGEAIAEQLQQQRIKAIKQAVHTERG :Sequence : :Sec Str :XXXXXXXXXXXXXXXXXX :SEG|360->378|lrlafraaaavtarplvaa :============================================== :BL:SWS|1->406|CCA_NITOC|0.0|100.0|406/406