[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA56917.1"

            "Aldehyde dehydrogenase"
            ""

OrgPattern 221-1-4754454653-312111-A4432-521-11111111211222124431-1--1-13351--1 6995L94799C547JPK9A-9O22Jb99999FSQWSNV**8N7U67781744VIODAA--DEO3CENMKKA----111-122H11111--12-211---52637484656--------------12222221221266687---64455334313111113122324555411111111111176856-1-C89999998AAAA99887EDAA6B9AB9HFDF86222221D54555555555555558667711112311111121122-11122---2222111-221111111111122212222222221--111---2-11162223223221-211-2223113131---2211---1--1---1118-6IEEA11111C6GBK5469A8A7FGHIFDHCHGH-45D43K6ANOB-NJJLLLWRNXQQE99C5AHQCAAC8IIEDEEEEEEADC6466811111111----1111-1111-11-11118APcA2BOKDDdYaaYbRKKKGaZcePPNMBNuVvLaTK14HDFD9CB9HDNDKP333-112A62444444132AC664413331332223-3333435443333BB15211322211211111111112-11143981894K7DB99AAAA9AB888987AB9BD-1-5421------A967587B998B878BC-9CAC988C7B98ABBABB9IJI99894A98998999A77A797J773667621466687657888--1633122888817DKW222112-----2223KJMGI7G7C9H1KKJKLPNUGTSOOCKHJ3211132122433A566668B88B89999A8555------1-441111--------2-2----1---1-12-111-12--111111112-2-2-331 ----CC9-A54-9B8IILKQNQKSTRSEECCCCEEDEFEEEEECDDDDKUUg*mOMFCDDDDD9B6AA4A88D9A894998AA9AC57-IUEICGDFDE9B8GFCF-9NBVOiHMOLBAEAFKFPQ5TCu*Q-SOUAEA9QDEOEAFDDAI89aCFDGNJbVCNEBAMBEGAKNC5765*55559JDYULGQ77VGLJH -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAFESVNPATGQSLKTFDAWDQNAIDGVLQQVQEASPLWAARDLSERCRLLRAAAQQLRE:Sequence :cEEEEEcTTTccEEEEEEcccHHHHHHHHHHHHcTTcHHHHccHHHHHHHHHHHHHHHHH:Sec Str : ==========================================================:RP:SCP|3->454|1uzbA|3e-88|28.2|450/516|c.82.1.1 :============================================================:BL:SWS|1->453|GABD_SYNY3|e-119|47.5|453/454 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->436|PF00171|1e-66|37.7|427/440|Aldedh 61: . . . * . .: 120 :RKEDLARLITLEMGKLLGEARAEIEKCAWVCEYYEEHAPRFLADEVIESDARRSYVALQP:Sequence :THHHHHHHHHHHHTccHHHHHTHHHHHHHHHHHHHHHGGGccccEEcccccEEEEEEEEE:Sec Str :============================================================:RP:SCP|3->454|1uzbA|3e-88|28.2|450/516|c.82.1.1 :============================================================:BL:SWS|1->453|GABD_SYNY3|e-119|47.5|453/454 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->436|PF00171|1e-66|37.7|427/440|Aldedh 121: . . + . . .: 180 :LGTVLAIMPWNFPFWQVFRFCAPALVAGNTAVLKHAANVPQCGLAIEQTLLEAGFPPGVF:Sequence :ccEEEEEcccccHHHHHHHHHHHHHHTTcEEEEEccTTccHHHHHHHHHHHHHTccTTcE:Sec Str :============================================================:RP:SCP|3->454|1uzbA|3e-88|28.2|450/516|c.82.1.1 :============================================================:BL:SWS|1->453|GABD_SYNY3|e-119|47.5|453/454 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->436|PF00171|1e-66|37.7|427/440|Aldedh 181: . * . . . .: 240 :RTLLVSSSQTAKVIADPRVQGVTLTGSEAAGRKVAECAGRHLKKTVLELGGADPFIVLAD:Sequence :EEccccTTTHHHHHTcTTccEEEEEccHHHHHHHHHHHHTTccEEEEEcccccEEEEcTT:Sec Str : ################# :PROS|203->219|PS00216|SUGAR_TRANSPORT_1|PDOC00190| :============================================================:RP:SCP|3->454|1uzbA|3e-88|28.2|450/516|c.82.1.1 :============================================================:BL:SWS|1->453|GABD_SYNY3|e-119|47.5|453/454 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->436|PF00171|1e-66|37.7|427/440|Aldedh 241: + . . . . *: 300 :ADLEQAVPVAVQSRFINGGQSCIAAKRFIVMEEIADEFIARFQADLEALQPGDPLDEQTT:Sequence :ccHHHHHHHHHHHHHTTTTccTTcccEEEEEHHHHHHHHHHHHHHHTccccccTTcTTcc:Sec Str : ############ :PROS|255->266|PS00070|ALDEHYDE_DEHYDR_CYS|PDOC00068| :============================================================:RP:SCP|3->454|1uzbA|3e-88|28.2|450/516|c.82.1.1 :============================================================:BL:SWS|1->453|GABD_SYNY3|e-119|47.5|453/454 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->436|PF00171|1e-66|37.7|427/440|Aldedh 301: . . . . + .: 360 :LAPLARLDLRAGLHQQVTASIQQGAVAVAGCQPLPGTGTYYAPSILDRVQPGMPAFDEEL:Sequence :ccccccHHHHHHHHHHHHHHHHTTcEEcccccEEcccccEEccEEEEcccTTcHHHHccc:Sec Str :============================================================:RP:SCP|3->454|1uzbA|3e-88|28.2|450/516|c.82.1.1 :============================================================:BL:SWS|1->453|GABD_SYNY3|e-119|47.5|453/454 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->436|PF00171|1e-66|37.7|427/440|Aldedh 361: . . . * . .: 420 :FGPVAAIIRVANEAEAVAMANASRYGLGGSVWSQNTSRAERLALELRCGAAFVNGLVKSD:Sequence :cccEEEEEEEccHHHHHHHHHccccccEEEEEcccHHHHHHHHHHccccEEEEccccccc:Sec Str : XXXXXXXXXXXXX :SEG|370->382|vaneaeavamana :============================================================:RP:SCP|3->454|1uzbA|3e-88|28.2|450/516|c.82.1.1 :============================================================:BL:SWS|1->453|GABD_SYNY3|e-119|47.5|453/454 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->436|PF00171|1e-66|37.7|427/440|Aldedh 421: . . + . . .: 480 :PRLPFGGIKCSGYGRELSWHGMREFTNQKTLWIK :Sequence :TTccccccGGGEEccccHHHHHHTTEEEEEEEEE :Sec Str :================================== :RP:SCP|3->454|1uzbA|3e-88|28.2|450/516|c.82.1.1 :================================= :BL:SWS|1->453|GABD_SYNY3|e-119|47.5|453/454 :$$$$$$$$$$$$$$$$ :RP:PFM|10->436|PF00171|1e-66|37.7|427/440|Aldedh