[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57001.1"

            "NADH dehydrogenase (quinone)"
            ""

OrgPattern 221112111111111141-1211-44455433-----1-----1111124544-31173622122-33 2232331322211121111-12--131111112242433311132324322-122222--34111423443--------21143412211111---1--1-111-23241--------------1432424422345665523334634333333334343434336333212211112112111211--2-2122222222122222232222222122433211111111223333333333333323334----------------------------------------------------------------------14--1----------1-------121--5--142211---3221131---343222322232211445434663333333332333-22322231314123344454325531444564565544311111111322-11562222222222221122222232332333311311-22222111111211112211111111112222111221113223332222223211211111111235212323-222-343224-33312432C333327-3132111111111111111111132322111-3-12-11------32-----133-451--544311111122321223332322222-3333322332323233333222321132222222222222222222233332-322222222222112522221111161131----2----------222222211141333333326333343331111111113----33323-----22323223332222113-111111------------------------------------1211----1-251 ---------------------------111---111-----------1------121-----2-1----------------------------1---11------1------11112-----1-11-1-12--11-----1--11--------1-1---1--11-112--1-13-1----------1-7--2------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPGRGSGLAVGGIFISALAVLPLSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVA:Sequence : :Sec Str : =============================:BL:SWS|32->400|NU5C_SYNP2|7e-52|39.0|369/664 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|33->88|PF00662|2e-05|35.7|56/61|Oxidored_q1_N 61: . . . * . .: 120 :WIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMLALVLSQSLLLLFIAWEGVGLASFVL:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|95->106|lalvlsqsllll :============================================================:BL:SWS|32->400|NU5C_SYNP2|7e-52|39.0|369/664 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|33->88|PF00662|2e-05|35.7|56/61|Oxidored_q1_N : $$$$$$$$$$$$$$:RP:PFM|107->367|PF00361|1e-32|38.4|258/268|Oxidored_q1 121: . . + . . .: 180 :IGQHHGQAKARQAAFKALLMTRLGDMGLLLGWLWMLMITGTTQLPPFFQQVEDGAFTAGT:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|143->157|lgdmglllgwlwmlm : XXXXXXX:SEG|174->192|gaftagtlnllallfflaa :============================================================:BL:SWS|32->400|NU5C_SYNP2|7e-52|39.0|369/664 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|107->367|PF00361|1e-32|38.4|258/268|Oxidored_q1 181: . * . . . .: 240 :LNLLALLFFLAAIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFE:Sequence : TTTEEEcc ccccccccccccEEEEcHHHHTTTcTHHH :Sec Str :XXXXXXXXXXXX :SEG|174->192|gaftagtlnllallfflaa : ===============================================:RP:SCP|194->275|1qd1A2|8e-13|15.9|69/140|d.58.34.1 :============================================================:BL:SWS|32->400|NU5C_SYNP2|7e-52|39.0|369/664 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|107->367|PF00361|1e-32|38.4|258/268|Oxidored_q1 241: + . . . . *: 300 :HAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQLGEMMLALGLGGPLGAAFH:Sequence :HHHHHHHHHHcccccccccHHHHHHHHHHHHHHTTcHHHHHHHHHHHHTTcccccHHHHH:Sec Str : XXXXXXXXXXXXXXXXX :SEG|282->298|lgemmlalglggplgaa :=================================== :RP:SCP|194->275|1qd1A2|8e-13|15.9|69/140|d.58.34.1 :============================================================:BL:SWS|32->400|NU5C_SYNP2|7e-52|39.0|369/664 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|107->367|PF00361|1e-32|38.4|258/268|Oxidored_q1 301: . . . . + .: 360 :LTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTAGAFIASALALAGFPLLSGY:Sequence :HHHHccccccccccccHHHHHTTccccccccccccHHHHHHHTTcEEEEEEccccccccc:Sec Str : XXXXXXXXXXXXXX :SEG|341->354|agafiasalalagf :============================================================:BL:SWS|32->400|NU5C_SYNP2|7e-52|39.0|369/664 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|107->367|PF00361|1e-32|38.4|258/268|Oxidored_q1 361: . . . * . .: 420 :WSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATFGLAPQAVMPANRRESAPLVG:Sequence :cTTccEEEEEEEETTcccccEEEEccccHHHHHH :Sec Str : XXXXX:SEG|416->434|aplvgpalglalaaaglga : ########################## :PROS|387->412|PS00217|SUGAR_TRANSPORT_2|PDOC00190| :======================================== :BL:SWS|32->400|NU5C_SYNP2|7e-52|39.0|369/664 :$$$$$$$ :RP:PFM|107->367|PF00361|1e-32|38.4|258/268|Oxidored_q1 421: . . + . . .: 480 :PALGLALAAAGLGAIIKTPIESMLSFEAGSATLTGAWTLSAILASLVGLGVGAWRVYHWG:Sequence : :Sec Str :XXXXXXXXXXXXXX :SEG|416->434|aplvgpalglalaaaglga 481: . * . . . .: 540 :PAPALGGWPSRLVVIIHGLVSGVARAAKAGALVLVWLERGFDGAARSFPTGIDRVSRQSD:Sequence : :Sec Str 541: + . . . . *: 600 :RRPIGTGP :Sequence : :Sec Str