[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57005.1"

            "Protein of unknown function DUF1328"
Y482_NITOC  "RecName: Full=UPF0391 membrane protein Noc_0482;"

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFGWAVTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLLLGRRGRPPL :Sequence : XXXXXXXXXXXXXXXXXXXXXXX :SEG|33->55|ilfvvglilfvvflllgrrgrpp :================================ :BL:SWS|1->32|Y482_NITOC|1e-14|100.0|32/56