[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57113.1"

            "Metallophosphoesterase"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------1------------------------------1----------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------2211-111111-----11231111-1121------1---1----1-----------11------------1---1--------------1----1---------------------------------1---113--1111----------------------11-1------1111-1-2432212322-5132222222422333233121-----212122222222221212--------1-----------1------------1-11------1---------1-----------11121--112212--------------------------11------------------------------------------------------------------------- ----------1-------------------------------------1-----------------------------------------------111----1----2-------------------------------------------------------------------------------------1-1-- -----------------------------1------------------------------1------------------------------------------------------------------------------------1--------------1--------------

Master   AminoSeq   


1: . . . . + .: 60 :MRFKRFSKNLAGKDYVVGDIHGTYSLLAQALERVGFDPSQDRLFAVGDLVDRGPESPDAL:Sequence : ccEHEEcccEEEEccccccHHHHHHHHHHTTccTTTcEEEEccccccccccHHHHH:Sec Str : ================================================:RP:SCP|13->221|1g5bA|5e-19|32.3|198/219|d.159.1.3 : ========================================================:BL:SWS|5->211|PP_LAMBD|7e-30|37.9|195/221 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->63|PF00149|5e-05|44.7|47/193|Metallophos 61: . . . * . .: 120 :TWLEYPWFHSCRGNHDEFVINAQNLEFDAAWWILVNGGEWWLDLDLTTRNLFSERFKQLP:Sequence :HHHHTGGEEEcccHHHHHHHHHHTTcccccGGGccHHHHTcHHccHTTHHHHHHHHHTcc:Sec Str :============================================================:RP:SCP|13->221|1g5bA|5e-19|32.3|198/219|d.159.1.3 :============================================================:BL:SWS|5->211|PP_LAMBD|7e-30|37.9|195/221 :$$$ :RP:PFM|17->63|PF00149|5e-05|44.7|47/193|Metallophos 121: . . + . . .: 180 :FAMEIETDQGKVGIVHADVPANLNWTRFVAEIERGNPAIHKYALWSRSRATGKCTTPVEG:Sequence :cEEEETTTTTTEEEEcccccTTccHTHHHHTccccEEEcTTcccEEEcHHHHHHHHHHHT:Sec Str :============================================================:RP:SCP|13->221|1g5bA|5e-19|32.3|198/219|d.159.1.3 :============================================================:BL:SWS|5->211|PP_LAMBD|7e-30|37.9|195/221 181: . * . . . .: 240 :IERVYCGHTVIKGGTLKIVGNVYFIDTGAAYTFLGARLTLLPLAYQQS :Sequence :ccEEEEcccccTTcEEEETTTTEccEEEEHH :Sec Str :========================================= :RP:SCP|13->221|1g5bA|5e-19|32.3|198/219|d.159.1.3 :=============================== :BL:SWS|5->211|PP_LAMBD|7e-30|37.9|195/221