[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57125.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------------------------1------------------------------------------------------------------------------------------------------------2111--2--1-----------1------------------------------------22-2-12222-1111111211111121111---1-----------------------------------------------------------------------------------------------1---------1--1---------------------------2--------1----1-------------22221111122122------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPQKLVKLSLYIVLTFVMGATMQGIGAPLESAIDAQVKADQAAARSQRKIDALSEETAEL:Sequence : XXXXXXXXX:SEG|52->63|alseetaellae : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->255|PF11932|2e-53|48.0|246/249|DUF3450 61: . . . * . .: 120 :LAEYRQVTTQLDSFRTYNRQLENLIRSQKEEFASLQQQLTDIEITQREIVPLMLRMVSSL:Sequence :XXX :SEG|52->63|alseetaellae : =======================================================:BL:SWS|66->171|VATI_ARCFU|1e-04|30.0|100/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->255|PF11932|2e-53|48.0|246/249|DUF3450 121: . . + . . .: 180 :KQFVALDIPFLPRERQTRIEQLQILMDRADVSLSEKYRRLIEAYQVEVEYGRTIEAYRGT:Sequence :=================================================== :BL:SWS|66->171|VATI_ARCFU|1e-04|30.0|100/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->255|PF11932|2e-53|48.0|246/249|DUF3450 181: . * . . . .: 240 :LDMDGKPHTVDFLRVGRTALFFYTLDGKTSGRWNAHGQSWVVLPDHYRAAIAEGLLIARK:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->255|PF11932|2e-53|48.0|246/249|DUF3450 241: + . . . . *: 300 :QAPPDLLLLPIQAPEAR :Sequence :$$$$$$$$$$$$$$$ :RP:PFM|10->255|PF11932|2e-53|48.0|246/249|DUF3450